DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and ZK938.3

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001364588.1 Gene:ZK938.3 / 191468 WormBaseID:WBGene00014160 Length:616 Species:Caenorhabditis elegans


Alignment Length:275 Identity:59/275 - (21%)
Similarity:111/275 - (40%) Gaps:48/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LAEEQLKRLAEQ-EGFKLRGQEFS-DYELMIASHLVVPADITVSWADIAGLDSVIQELRESVVLP 116
            ||:.:|..|..| |..|:..::|. |:...:...:..|..:. :|......|..:|         
 Worm   375 LAQIELSELTSQREICKIENRQFKFDFRSFLVQTVCTPCSLG-TWQKQKSKDQKMQ--------- 429

  Fly   117 IQHKDLFKHSKLWQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGESQKLTS 181
                        |     :||.|.|..|||..|:|.::...:..:::...::.   .|: :|:.:
 Worm   430 ------------W-----LLLSGAPDSGKTTWARAISRACHVTHVHISKNVVN---MGK-RKIYT 473

  Fly   182 AVFSLASRIEPCIIFIDEIDSFLRSRNMNDHEATAMMKTQFMMLWDGLSTNAN-STVIVMGATNR 245
            .|..||.:.:..::.||.||...:......:....::...|      ||..:| ..|:|:|.|..
 Worm   474 VVKKLAKQEKRLLVSIDRIDVMKKDPKHKGYTHRQILLRNF------LSDLSNIKFVMVIGMTRV 532

  Fly   246 P-QDLDKAIVRRMPAQFHIGLPSETQRKDILKLILQSEEVSQDVDLNRLSKLTNGFSGSDLREMC 309
            | .|||..|....|.|..:..|:...|.|     |..:.:|::.:..||.|..|..  .|:.:..
 Worm   533 PLDDLDSYISDLFPLQATLSNPTNATRYD-----LAVDCLSRNWEQERLPKFPNRI--FDIEKQT 590

  Fly   310 RNASVYRMRQLITSR 324
            ::.:..:..:.:|:|
 Worm   591 KDQTRGKAAKFVTNR 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 33/135 (24%)
AAA 135..265 CDD:278434 33/131 (25%)
ZK938.3NP_001364588.1 P-loop_NTPase 431..545 CDD:422963 31/123 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.