DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and vps-4

DIOPT Version :10

Sequence 1:NP_609373.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_490816.4 Gene:vps-4 / 189590 WormBaseID:WBGene00021334 Length:430 Species:Caenorhabditis elegans


Alignment Length:53 Identity:14/53 - (26%)
Similarity:23/53 - (43%) Gaps:15/53 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RTKDTSGSSMNAISFGFVATAILILMFIIMAILEHLF--RSDHSSSYDVDDSS 64
            :|..||||.::: :||            :..|.|..|  |..:.:.|..:|.|
 Worm   371 KTSRTSGSQLSS-TFG------------VPEISEGGFNKRDSYQNDYQEEDDS 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_609373.1 RecA-like_ATAD1 98..263 CDD:410928
AAA_lid_3 287..323 CDD:465537
vps-4NP_490816.4 MIT_VPS4 4..79 CDD:239141
RecA-like_VPS4 112..282 CDD:410929
AAA_lid_3 307..350 CDD:465537
Vps4_C 365..425 CDD:462762 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.