DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and Nsf

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_032766.2 Gene:Nsf / 18195 MGIID:104560 Length:744 Species:Mus musculus


Alignment Length:352 Identity:93/352 - (26%)
Similarity:157/352 - (44%) Gaps:76/352 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LRGQEFSDYELMIASHLVV-PADITVSWADIAGLDSV----IQELRESVVLP------------- 116
            |:|:..|.....|...||| .:.:....|:.:.|:.:    .:|.|:|::.|             
Mouse   160 LKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLD 224

  Fly   117 IQHKDLFKH---SKLW----------QAPKGVLLHGPPGCGKTLIAKATAKEAGMR---FINLDV 165
            .:..|:|:.   |:::          :..||:||:|||||||||:|:...|....|   .:| ..
Mouse   225 KEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVN-GP 288

  Fly   166 AILTDKWYGESQKLTSAVFS--------LASRIEPCIIFIDEIDSFLRSR-----NMNDHEATAM 217
            .|| :|:.|||:.....:|:        |.:.....||..||||:..:.|     :...|:... 
Mouse   289 EIL-NKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVV- 351

  Fly   218 MKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVR--RMPAQFHIGLPSETQRKDILKL--- 277
              .|.:...||:....|  ::|:|.||||..:|:|::|  |:..:..||||.|..|..||.:   
Mouse   352 --NQLLSKIDGVEQLNN--ILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTA 412

  Fly   278 -ILQSEEVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSRDPSATALDR-NNVRITM 340
             :...:.:|.|||:..|:..|..|||::|..:.|.|....|.:.|.:.......::: .::::|.
Mouse   413 RMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTR 477

  Fly   341 DDLLGSHLKIKESKMHTSSLFLENRIE 367
            .|.|.|               |||.|:
Mouse   478 GDFLAS---------------LENDIK 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 49/151 (32%)
AAA 135..265 CDD:278434 46/147 (31%)
NsfNP_032766.2 CDC48_N 6..83 CDD:215012
CDC48_2 111..183 CDD:215011 7/22 (32%)
AAA 254..399 CDD:214640 50/151 (33%)
AAA 256..397 CDD:278434 46/147 (31%)
AAA 538..670 CDD:214640
AAA 539..668 CDD:278434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.