DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and mac-1

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_496814.1 Gene:mac-1 / 174974 WormBaseID:WBGene00003119 Length:813 Species:Caenorhabditis elegans


Alignment Length:346 Identity:102/346 - (29%)
Similarity:168/346 - (48%) Gaps:47/346 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GGSDLSKGQIFQVLVRLSVASLITYYSVKWMMNQMDPTSKNKKKAKV-LAEEQLKR-------LA 63
            |..:|:..||.:.|.|:          :.|:....||::.::....: ::.|..:|       .|
 Worm   465 GHKNLTVEQIKEELDRV----------LAWLQGDDDPSALSELNGGLQISFEDFERALSTIQPAA 519

  Fly    64 EQEGFKLRGQEFSDYELMIASHLVVPADITVSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKL 128
            ::|||                 ..||   .|||.||..|..|.::|..|::.||:..|.|....:
 Worm   520 KREGF-----------------ATVP---DVSWDDIGALVEVRKQLEWSILYPIKRADDFAALGI 564

  Fly   129 WQAPKGVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGESQKLTSAVFSLASRIEPC 193
            ...|:|:||.|||||||||:|||.|.|.||.||::....|.:.:.|||::....||..|...:||
 Worm   565 DCRPQGILLCGPPGCGKTLLAKAVANETGMNFISVKGPELLNMYVGESERAVRTVFQRARDSQPC 629

  Fly   194 IIFIDEIDSFLRSRNMNDHEATAMMKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVR--R 256
            :||.||||:.:..|:..:....|.:..|.:...||:  .....|.::||||||..:|.||:|  |
 Worm   630 VIFFDEIDALVPKRSHGESSGGARLVNQLLTEMDGV--EGRQKVFLIGATNRPDIVDAAILRPGR 692

  Fly   257 MPAQFHIGLPSETQRKDILKLILQS---EEVSQDVDLNRLSKLTN--GFSGSDLREMCRNASVYR 316
            :.....:..||...|.|||:...::   ..:.:|:|.:.:::|..  ||:|:||..:...:|:..
 Worm   693 LDKILFVDFPSVEDRVDILRKSTKNGTRPMLGEDIDFHEIAQLPELAGFTGADLAALIHESSLLA 757

  Fly   317 MRQLITSRDPSATALDRNNVR 337
            ::..:...|.|...:...:.|
 Worm   758 LQARVLENDESVKGVGMRHFR 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 54/135 (40%)
AAA 135..265 CDD:278434 52/131 (40%)
mac-1NP_496814.1 Nucleolin_bd 5..65 CDD:318849
TIP49 <191..804 CDD:332389 102/346 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.