DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmd and cdc-48.1

DIOPT Version :9

Sequence 1:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_496273.1 Gene:cdc-48.1 / 174624 WormBaseID:WBGene00007352 Length:809 Species:Caenorhabditis elegans


Alignment Length:329 Identity:115/329 - (34%)
Similarity:169/329 - (51%) Gaps:41/329 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GLGGSDL----SKGQIFQVLVRLSVASLITYYSVKWMMNQMDPTSKNKKKAKVLAEEQLKRLA-E 64
            |..|:||    |:..:.|:..::.:..|..        :|:|             .|.|..|| .
 Worm   411 GFVGADLASLCSEAALQQIREKMELIDLED--------DQID-------------AEVLNSLAVT 454

  Fly    65 QEGFKLRGQEFSDYELMIASHLVVPADITVSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKLW 129
            .|.|:....:.|...|..|   ||....| :|:||.||.:|.:||:|.|..|::|.:  |:.|..
 Worm   455 MENFRFAQGKSSPSALREA---VVETPNT-TWSDIGGLQNVKRELQELVQYPVEHPE--KYLKFG 513

  Fly   130 QAP-KGVLLHGPPGCGKTLIAKATAKEAGMRFINLDVAILTDKWYGESQKLTSAVFSLASRIEPC 193
            ..| :|||.:|||||||||:|||.|.|....||::....|...|:|||:.....||..|....||
 Worm   514 MQPSRGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARAAAPC 578

  Fly   194 IIFIDEIDSFLRSR----NMNDHEATAMMKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIV 254
            ::|.||:||..::|    ..:...|:..:..|.:...||:  ||...|.::||||||..:|.|::
 Worm   579 VLFFDELDSIAKARGGGAGGDGGGASDRVINQVLTEMDGM--NAKKNVFIIGATNRPDIIDPAVL 641

  Fly   255 R--RMPAQFHIGLPSETQRKDILKLILQSEEVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRM 317
            |  |:....:|.||.|..|..|||..|:...:|:|:||..|:|.|.||||:||.|:|:.|....:
 Worm   642 RPGRLDQLIYIPLPDEASRHQILKASLRKTPLSKDLDLTFLAKNTVGFSGADLTEICQRACKLAI 706

  Fly   318 RQLI 321
            |:.|
 Worm   707 RESI 710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdNP_001285801.1 AAA 132..266 CDD:214640 54/140 (39%)
AAA 135..265 CDD:278434 52/135 (39%)
cdc-48.1NP_496273.1 CDC48_N 31..112 CDD:280513
CDC48 52..775 CDD:273521 115/329 (35%)
CDC48_2 137..197 CDD:215011
AAA 247..376 CDD:278434
AAA 520..654 CDD:278434 52/135 (39%)
Vps4_C <727..771 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.