DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cas and K05F1.13

DIOPT Version :9

Sequence 1:NP_524677.1 Gene:cas / 44018 FlyBaseID:FBgn0004878 Length:793 Species:Drosophila melanogaster
Sequence 2:NP_001333552.1 Gene:K05F1.13 / 29991191 WormBaseID:WBGene00270309 Length:192 Species:Caenorhabditis elegans


Alignment Length:205 Identity:42/205 - (20%)
Similarity:76/205 - (37%) Gaps:63/205 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 LKLGFARFSSSDDCAPAYGEGCAYNWKQTHYHCVYEHCPKVYVSTSDVQMHAN----FHRKDSEI 469
            :.:.:.:|...||....:|        ..|.||.::.|   ..:::|..:.:|    ||.|:|||
 Worm     1 MSINYFKFDCDDDLCKYHG--------IAHLHCGHKRC---NFASNDALLISNHLSVFHLKNSEI 54

  Fly   470 VNEGFRRFRAH--ETCRIEDCPFFGKKISHYHCCREGCTHTFKNKADMDKHKTYHLKDHQLKMDG 532
            .::   |...|  .:|..:.|. |.:..||:||.:  |                        ..|
 Worm    55 PDD---RIFYHIDVSCGSDRCQ-FNRNSSHWHCAK--C------------------------QTG 89

  Fly   533 FKKILKTEVCP-------FDACKFSTVCN-----HIHCVREGCDYILHSSSQMISHKRKHDRQDG 585
            | :|:....||       .|:|. ...|.     |.||  :.||....:::::.:|..:..:...
 Worm    90 F-EIVGLHCCPITSLPKRLDSCS-RPFCKLKKKAHFHC--KICDQGFSNNTKLANHTHRTQKLQK 150

  Fly   586 EQAYQQFKIK 595
            ....:..|:|
 Worm   151 NICIENGKLK 160



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006505
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.