DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cas and lect-2

DIOPT Version :9

Sequence 1:NP_524677.1 Gene:cas / 44018 FlyBaseID:FBgn0004878 Length:793 Species:Drosophila melanogaster
Sequence 2:NP_495141.2 Gene:lect-2 / 173978 WormBaseID:WBGene00019407 Length:335 Species:Caenorhabditis elegans


Alignment Length:173 Identity:34/173 - (19%)
Similarity:57/173 - (32%) Gaps:54/173 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 QQQQQQHL---LTTSNLLLTPTHTPSSLGKQDPLQHPLLLGQFAGSEQMATNNFLQSSTVTSTPI 204
            |...:.|:   |.....|:.|||         .||:.:..||...|.   |.|.|     ...|.
 Worm   146 QNDVEPHVEIRLYKEGRLIDPTH---------HLQNCMCTGQICESN---TRNVL-----LGDPF 193

  Fly   205 EREKAATPAPSAGATAGNLSAAQVKFEQESADDDEDDDKPLS---------------SLTSCSSS 254
            :.:|...     |....::....:        ||:|:|.|.:               .|.:.|:.
 Worm   194 KTDKRYN-----GVRGWDVECQMI--------DDDDEDSPRAPMIYSPIAGEIVGRIRLFTDSNG 245

  Fly   255 GHTNASSEKLLLSGVHPLESTTDSLDSPSMYTPVKQPADSSYG 297
            .:|...::.:.:.|:      .|.|...:....||..||..:|
 Worm   246 AYTGCDNDGIFIVGI------DDWLGFEARLYNVKARADIGFG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
casNP_524677.1 None
lect-2NP_495141.2 Peptidase_M23 60..166 CDD:366703 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4377
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.