DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sol and RIM13

DIOPT Version :9

Sequence 1:NP_476738.3 Gene:sol / 44014 FlyBaseID:FBgn0003464 Length:1594 Species:Drosophila melanogaster
Sequence 2:NP_013875.1 Gene:RIM13 / 855186 SGDID:S000004763 Length:727 Species:Saccharomyces cerevisiae


Alignment Length:426 Identity:91/426 - (21%)
Similarity:150/426 - (35%) Gaps:158/426 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   944 SVVCDICSSPRGLASAVLGEALGRKSVRVALTPAD--------IRQE--SKLMENLRQLEETEAL 998
            |:.|    :..|.:|:::...:|     :|:...|        :.:|  ||:.:.||.|..|..:
Yeast    13 SIYC----NAEGDSSSIINRLVG-----LAMKSEDSTFIEAVLVLKENVSKVDKQLRFLWLTSTI 68

  Fly   999 TKWQNIIQYCRDNSELFVDDSFPPAPKS----LYYNPASGAGEGNPVVQWRRP------HEINCD 1053
                        ||..     :||.|.|    :.:|.......|...:|.|.|      :|.:..
Yeast    69 ------------NSRF-----YPPIPISEASPVSWNKTEYCAPGTEELQRRYPGRAKLQNEEDYS 116

  Fly  1054 GGAYPPWAVFRTPLPSDICQGVLGNCWLLSALAVLAERE---DLVKEV----------------- 1098
            ||.             :.|:.| .:|.|:::|..|..:.   .|:|::                 
Yeast   117 GGI-------------EQCRDV-PDCSLVASLINLRSKNLNLPLIKQISSTKYHVNLSFNGSNKR 167

  Fly  1099 LVTKEICGQGAYQVRLCKDGKWTTVLVDDLLPCDKRGHLVYSQAKRKQLWVPLIEKAVAKIHGCY 1163
            |||.:|.     |:....|||..::..:|:  .||.|.|.          :.|:.|......|..
Yeast   168 LVTVDIS-----QIPTSVDGKQLSLKSNDI--SDKIGELA----------LLLVSKGTYSTDGSN 215

  Fly  1164 EALVSGRAIEGLATLTGAPCESIPLQASSLPMPSEDELDKDLIWAQLLSSRCVRFLMGASCGGGN 1228
            .::.:.|....|..:|         |.:|.|.        :.:|....|:.|   ||||  |.||
Yeast   216 ISIDTYRLSGFLPEIT---------QVNSYPF--------EKLWKFHKSNLC---LMGA--GTGN 258

  Fly  1229 MKVDEEEYQQKGLRPRHAYSVLDVKDIQGHRLLKLRNPWGHYSWRGDWSDDSSLWTDDLRDALMP 1293
            ...|    ..|.|...|.||::|:  ....||:|||:|           .:|:|..:        
Yeast   259 RSND----MIKPLVENHDYSIIDI--TYDSRLVKLRDP-----------RNSALNVE-------- 298

  Fly  1294 HGASEGVFWISFEDVLNYFDCIDICKVRSGWNEVRL 1329
                     ||:|..|..|.     ::...||:.:|
Yeast   299 ---------ISYEQYLKNFK-----QLYLNWNQEKL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
solNP_476738.3 zf-RanBP 6..34 CDD:279035
RanBP2-type Zn finger 10..29 CDD:275376
zf-RanBP 135..164 CDD:279035
zf-RanBP 643..672 CDD:279035
RanBP2-type Zn finger 647..667 CDD:275375
zf-RanBP 704..731 CDD:279035
RanBP2-type Zn finger 708..727 CDD:275376
zf-RanBP 747..774 CDD:279035
RanBP2-type Zn finger 749..768 CDD:275376
zf-RanBP 927..954 CDD:279035 2/9 (22%)
RanBP2-type Zn finger 931..950 CDD:275376 2/5 (40%)
CysPc 1001..1328 CDD:128526 76/356 (21%)
RIM13NP_013875.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.