DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sol and CAPN2

DIOPT Version :9

Sequence 1:NP_476738.3 Gene:sol / 44014 FlyBaseID:FBgn0003464 Length:1594 Species:Drosophila melanogaster
Sequence 2:NP_001739.3 Gene:CAPN2 / 824 HGNCID:1479 Length:700 Species:Homo sapiens


Alignment Length:378 Identity:117/378 - (30%)
Similarity:172/378 - (45%) Gaps:66/378 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   993 EETEALTKWQNIIQY-----------CRDNSELFVDDSFPPAPKSLYY---NPASGAGEGNPVVQ 1043
            |..|.|......|:|           |.:...||.|.|||..|.:|.:   .|.|....|   ::
Human    13 EAAEGLGSHDRAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGFKELGPYSSKTRG---IE 74

  Fly  1044 WRRPHEINCD-----GGAYPPWAVFRTPLPSDICQGVLGNCWLLSALAVLAEREDLVKEVLVTKE 1103
            |:||.||..|     |||      .||    |||||.||:||||:|:|.|...|:::..|:...:
Human    75 WKRPTEICADPQFIIGGA------TRT----DICQGALGDCWLLAAIASLTLNEEILARVVPLNQ 129

  Fly  1104 ICGQ---GAYQVRLCKDGKWTTVLVDDLLPCDKRGHLVY-SQAKRKQLWVPLIEKAVAKIHGCYE 1164
            ...:   |.:..:..:.|:|..|:|||.|| .|.|.|:: ..|:..:.|..|:|||.|||:||||
Human   130 SFQENYAGIFHFQFWQYGEWVEVVVDDRLP-TKDGELLFVHSAEGSEFWSALLEKAYAKINGCYE 193

  Fly  1165 ALVSGRAIEGLATLTGAPCESIPLQASSLPMPSEDE-LDKDLIWAQLLSSRCVRFLMGASCGGGN 1228
            ||..|...||....||...|...|:.   |.|:..: :.|.|....||.  |...:..|:     
Human   194 ALSGGATTEGFEDFTGGIAEWYELKK---PPPNLFKIIQKALQKGSLLG--CSIDITSAA----- 248

  Fly  1229 MKVDEEEYQQKGLRPRHAYSVLDVKDIQGH----RLLKLRNPWGHYSWRGDWSDDSSLWT--DDL 1287
               |.|....:.|...|||||...::::.:    :|:::|||||...|.|.|:|:...|.  |..
Human   249 ---DSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDNCPSWNTIDPE 310

  Fly  1288 RDALMPHGASEGVFWISFEDVLNYFDCIDICKVR---------SGWNEVRLQG 1331
            ....:.....:|.||:||.|.|.::..::||.:.         ..|...::.|
Human   311 ERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTKMDG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
solNP_476738.3 zf-RanBP 6..34 CDD:279035
RanBP2-type Zn finger 10..29 CDD:275376
zf-RanBP 135..164 CDD:279035
zf-RanBP 643..672 CDD:279035
RanBP2-type Zn finger 647..667 CDD:275375
zf-RanBP 704..731 CDD:279035
RanBP2-type Zn finger 708..727 CDD:275376
zf-RanBP 747..774 CDD:279035
RanBP2-type Zn finger 749..768 CDD:275376
zf-RanBP 927..954 CDD:279035
RanBP2-type Zn finger 931..950 CDD:275376
CysPc 1001..1328 CDD:128526 113/365 (31%)
CAPN2NP_001739.3 Peptidase_C2 46..342 CDD:306994 107/322 (33%)
Domain III 345..514 2/19 (11%)
Calpain_III 363..507 CDD:307285 1/1 (100%)
Linker 515..529
Domain IV 530..700
EFh_PEF_CAPN2 533..700 CDD:320074
EF-hand motif 533..561 CDD:320074
EF-hand motif 576..605 CDD:320074
EF-hand motif 606..636 CDD:320074
EF-hand motif 642..670 CDD:320074
EF-hand motif 672..700 CDD:320074
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.