DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sol and Capn12

DIOPT Version :9

Sequence 1:NP_476738.3 Gene:sol / 44014 FlyBaseID:FBgn0003464 Length:1594 Species:Drosophila melanogaster
Sequence 2:NP_001104277.1 Gene:Capn12 / 60594 MGIID:1891369 Length:720 Species:Mus musculus


Alignment Length:468 Identity:139/468 - (29%)
Similarity:203/468 - (43%) Gaps:99/468 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   998 LTKWQN---IIQYCRDNSELFVDDSFPPAPKSLYYNPASGAGEGNPVVQWRRPHEINCDGGAYPP 1059
            |.|.||   |.:.|.|:..||.|..||..|.:|.|:......|....|:|:||||...:     |
Mouse    26 LFKGQNYEAIRRACLDSGILFRDPCFPAGPDALGYDKLGPDSEKAKGVEWKRPHEFCAE-----P 85

  Fly  1060 WAVFRTPLPSDICQGVLGNCWLLSALAVLAEREDLVKEVLVTKEICGQ-------GAYQVRLCKD 1117
            ..:......:|:|||.|||||||:|.|.|.....|:..|:..    ||       |.:..:|.:.
Mouse    86 QFICEDMSRTDVCQGSLGNCWLLAAAASLTLYPRLLYRVVPP----GQGFQDGYAGVFHFQLWQF 146

  Fly  1118 GKWTTVLVDDLLPCDKRGHLVYSQA-KRKQLWVPLIEKAVAKIHGCYEALVSGRAIEGLATLTGA 1181
            |:|..|:|||.||. :.|.|::.:: :|.:.|.||:|||.||:||.||.:..|...|.....||.
Mouse   147 GRWVDVVVDDKLPV-REGKLMFVRSEQRNEFWAPLLEKAYAKLHGSYEVMRGGHMNEAFVDFTGG 210

  Fly  1182 PCESIPLQASSLPMPSEDELDKDLIWAQLLSSRCVRFLMGASC--GGGNMKVDEEEYQQKGLRPR 1244
            ..|.:.|:.::   |.        ::|.|..:.....|:||:.  ..|.::.||      ||...
Mouse   211 VGEVLYLRQNT---PG--------VFAALRHALAKESLVGATALSDRGEIRTDE------GLVKG 258

  Fly  1245 HAYSVLDVKDIQ-GH---RLLKLRNPWGHYSWRGDWSDDSSLW---TDDLRDALMPHGASEGVFW 1302
            |||||.....:. |.   |||:||||||...|.|.|||....|   ..:.||||:.. ..:|.||
Mouse   259 HAYSVTGTHKMSLGFTKVRLLRLRNPWGRVEWSGPWSDSCPRWDMLPSEWRDALLVK-KEDGEFW 322

  Fly  1303 ISFEDVLNYFDCIDICKVR----------SGWNEVRLQG-------------TLQPLCSISCVLL 1344
            :..:|.|.:|:.:.||.:.          .||:....||             :.:...:.....|
Mouse   323 MELQDFLTHFNTVQICSLSPEVLGPSPAGGGWHIHIFQGRWVRGFNSGGSQPSAENFWTNPQFRL 387

  Fly  1345 TVLEPTEAEFTLFQE---------GQRNSEKSQRSQLDLCVVIFRTRSPAAPEIGRLVEHSKRQV 1400
            |:|||.|.|....:|         |.|...:..|  :..|.|:.           .|::.::|.:
Mouse   388 TLLEPDEEEDDDDEEGPWGGWGAAGARGPARGGR--VPKCTVLL-----------SLIQRNRRCL 439

  Fly  1401 RG------FVGCH 1407
            |.      .||.|
Mouse   440 RAKGLTYLTVGFH 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
solNP_476738.3 zf-RanBP 6..34 CDD:279035
RanBP2-type Zn finger 10..29 CDD:275376
zf-RanBP 135..164 CDD:279035
zf-RanBP 643..672 CDD:279035
RanBP2-type Zn finger 647..667 CDD:275375
zf-RanBP 704..731 CDD:279035
RanBP2-type Zn finger 708..727 CDD:275376
zf-RanBP 747..774 CDD:279035
RanBP2-type Zn finger 749..768 CDD:275376
zf-RanBP 927..954 CDD:279035
RanBP2-type Zn finger 931..950 CDD:275376
CysPc 1001..1328 CDD:128526 116/356 (33%)
Capn12NP_001104277.1 Peptidase_C2 46..339 CDD:279042 107/320 (33%)
Domain III 342..541 23/124 (19%)
Calpain_III 352..531 CDD:238132 23/114 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..415 4/21 (19%)
Domain IV 542..720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.