DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sol and capn1b

DIOPT Version :9

Sequence 1:NP_476738.3 Gene:sol / 44014 FlyBaseID:FBgn0003464 Length:1594 Species:Drosophila melanogaster
Sequence 2:XP_005174088.1 Gene:capn1b / 565106 ZFINID:ZDB-GENE-060503-491 Length:704 Species:Danio rerio


Alignment Length:364 Identity:120/364 - (32%)
Similarity:177/364 - (48%) Gaps:63/364 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1001 WQNIIQYCRDNSELFVDDSFPPAPKSLYYN---PASGAGEGNPVVQWRRPHEINCD-----GGAY 1057
            ::.:.:.|.::..||.|..||..|:||.:.   |.|....|   |:|.||.|::.:     ||| 
Zfish    35 YEELRRECVESGRLFEDPCFPAVPQSLGFKELAPNSSKTRG---VKWIRPTELSENPQFIVGGA- 95

  Fly  1058 PPWAVFRTPLPSDICQGVLGNCWLLSALAVLAEREDLVKEVL-----VTKEICGQGAYQVRLCKD 1117
                 .||    |||||.||:||||:|:|.|...:.|:..|:     .|.|..  |.:..:..:.
Zfish    96 -----TRT----DICQGALGDCWLLAAIASLTLNDKLLHRVVPHGQSFTNEYA--GIFHFQFWQF 149

  Fly  1118 GKWTTVLVDDLLPC-DKRGHLVYSQAKRKQLWVPLIEKAVAKIHGCYEALVSGRAIEGLATLTGA 1181
            |:|..:::||.||. ||....|:| |:..:.|..|:|||.||::|.||||..|...||....||.
Zfish   150 GEWVDIVIDDRLPVKDKELMFVHS-AEGNEFWSALLEKAYAKLNGSYEALSGGSTTEGFEDFTGG 213

  Fly  1182 PCESIPLQASSLPMPSEDELDKDL--IWAQLLSSRCVRFLMGASCGGGNMKVDEEEYQQKGLRPR 1244
            ..|...|:::          .|||  |.|:.|....   |:|.|. ......|.|....|.|...
Zfish   214 VAEMYELRSA----------PKDLHRIIAKALERGS---LLGCSI-DITSAFDMEAVTFKKLVKG 264

  Fly  1245 HAYSVLDVKDI--QGH--RLLKLRNPWGHYSWRGDWSDDSSLWT---DDLRDALMPHGASEGVFW 1302
            |||||..::::  :|:  ||:::|||||...|.|.|||:||.|.   ...|:.|..| ..:|.||
Zfish   265 HAYSVTALREVNFRGNRERLIRIRNPWGQVEWTGAWSDNSSEWNGIDPSEREELNNH-MEDGEFW 328

  Fly  1303 ISFEDVLNYFDCIDICKV---------RSGWNEVRLQGT 1332
            :||::....|..::||.:         :..||.::..||
Zfish   329 MSFQEFKRQFSRLEICNLTPDALSDDSQHFWNTIQFNGT 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
solNP_476738.3 zf-RanBP 6..34 CDD:279035
RanBP2-type Zn finger 10..29 CDD:275376
zf-RanBP 135..164 CDD:279035
zf-RanBP 643..672 CDD:279035
RanBP2-type Zn finger 647..667 CDD:275375
zf-RanBP 704..731 CDD:279035
RanBP2-type Zn finger 708..727 CDD:275376
zf-RanBP 747..774 CDD:279035
RanBP2-type Zn finger 749..768 CDD:275376
zf-RanBP 927..954 CDD:279035
RanBP2-type Zn finger 931..950 CDD:275376
CysPc 1001..1328 CDD:128526 118/358 (33%)
capn1bXP_005174088.1 Peptidase_C2 49..345 CDD:279042 113/326 (35%)
Calpain_III 359..510 CDD:279416 4/9 (44%)
PTZ00184 527..666 CDD:185504
EFh 581..631 CDD:298682
EFh 614..667 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.