DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sol and capn2b

DIOPT Version :9

Sequence 1:NP_476738.3 Gene:sol / 44014 FlyBaseID:FBgn0003464 Length:1594 Species:Drosophila melanogaster
Sequence 2:NP_001018177.1 Gene:capn2b / 563053 ZFINID:ZDB-GENE-050522-84 Length:696 Species:Danio rerio


Alignment Length:343 Identity:115/343 - (33%)
Similarity:167/343 - (48%) Gaps:51/343 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   999 TKWQN-----IIQYCRDNSELFVDDSFPPAPKSLYY---NPASGAGEGNPVVQWRRPHEINCD-- 1053
            ||:.|     :...||....||.|.:||.||:||.:   .|.|....|   :.|:||.|: |.  
Zfish    25 TKYLNQDFEALRSECRARGTLFSDPTFPAAPESLGFKELGPNSSKTRG---LVWKRPGEL-CQKP 85

  Fly  1054 ----GGAYPPWAVFRTPLPSDICQGVLGNCWLLSALAVLAEREDLVKEVLVT-KEICG--QGAYQ 1111
                |||          ..:|||||.||:||||:|:|.|.:.||::..|:.. :|..|  .|.:.
Zfish    86 RFIVGGA----------TKTDICQGALGDCWLLAAIASLTQNEDVLARVVPNGQEFDGTYAGIFH 140

  Fly  1112 VRLCKDGKWTTVLVDDLLPCDKRGHL--VYSQAKRKQLWVPLIEKAVAKIHGCYEALVSGRAIEG 1174
            .:..:.|:|..|::||.||. |.|.|  ||| |::.:.|..|:|||.||::||||||..|...||
Zfish   141 FQFWQFGEWVDVVIDDRLPV-KDGELLFVYS-AEKNEFWSALLEKAYAKVNGCYEALSGGSTSEG 203

  Fly  1175 LATLTGAPCESIPLQASSLPMPSEDELDKDLIWAQLLSSRCVRFLMGASCGGGNMKVDEEEYQQK 1239
            ....||...||..::.:  |......:.|.|....||.  |...:..|:        |.|...::
Zfish   204 FEDFTGGIAESYEIRKA--PTNLFQIIQKALEAGALLG--CSIDITSAA--------DSEAITRQ 256

  Fly  1240 GLRPRHAYSVLDVKDI----QGHRLLKLRNPWGHYSWRGDWSDDSSLWTDDLRDALMPHGASEGV 1300
            .|...||||:....::    :..:|:::|||||...|.|.|||:|..|............|.:|.
Zfish   257 KLVKGHAYSLTGATEVNYRGRKEKLVRMRNPWGQVEWTGAWSDNSPEWNSVAASERPDASAEDGE 321

  Fly  1301 FWISFEDVLNYFDCIDIC 1318
            ||::|.:.|..:..|:||
Zfish   322 FWMAFSEFLTNYSRIEIC 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
solNP_476738.3 zf-RanBP 6..34 CDD:279035
RanBP2-type Zn finger 10..29 CDD:275376
zf-RanBP 135..164 CDD:279035
zf-RanBP 643..672 CDD:279035
RanBP2-type Zn finger 647..667 CDD:275375
zf-RanBP 704..731 CDD:279035
RanBP2-type Zn finger 708..727 CDD:275376
zf-RanBP 747..774 CDD:279035
RanBP2-type Zn finger 749..768 CDD:275376
zf-RanBP 927..954 CDD:279035
RanBP2-type Zn finger 931..950 CDD:275376
CysPc 1001..1328 CDD:128526 113/341 (33%)
capn2bNP_001018177.1 Peptidase_C2 46..339 CDD:279042 107/320 (33%)
Calpain_III 354..503 CDD:279416
EFh 573..628 CDD:238008
FRQ1 601..>686 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.