DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sol and capn1a

DIOPT Version :9

Sequence 1:NP_476738.3 Gene:sol / 44014 FlyBaseID:FBgn0003464 Length:1594 Species:Drosophila melanogaster
Sequence 2:NP_956739.1 Gene:capn1a / 393417 ZFINID:ZDB-GENE-040426-1263 Length:704 Species:Danio rerio


Alignment Length:484 Identity:136/484 - (28%)
Similarity:199/484 - (41%) Gaps:115/484 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   991 QLEETEALTKWQNIIQYCRDNSELFVDDSFPPAPKSLYYNPASGAGEGNPVVQWRRPHEINCDGG 1055
            |.::.|||.      |.|.:...||.|..||..|.||.:...:........|:|.||.|: ||..
Zfish    31 QNQDYEALR------QECLEGGYLFEDPCFPAEPPSLGFKELAPHSSKTRDVEWMRPTEL-CDDP 88

  Fly  1056 AYPPWAVFRTPLPSDICQGVLGNCWLLSALAVLAEREDLVKEVLVTKEICGQ-------GAYQVR 1113
            .:......||    |||||.||:||||:|:..|...|.|:..|:..    ||       |.:..:
Zfish    89 QFIVGGATRT----DICQGALGDCWLLAAIGSLTLNERLLHRVVPH----GQSFQDDYAGIFHFQ 145

  Fly  1114 LCKDGKWTTVLVDDLLPCDKRGHLVY-SQAKRKQLWVPLIEKAVAKIHGCYEALVSGRAIEGLAT 1177
            ..:.|:|..:::||.||. |.|.|:: ..|:..:.|..|:|||.||::|.||||..|...||...
Zfish   146 FWQFGEWVDIVIDDRLPV-KDGELMFVHSAEGNEFWSALVEKAYAKLNGSYEALSGGSTTEGFED 209

  Fly  1178 LTGAPCESIPLQASSLPMPSEDELDKDLIWAQLLSSRCVR-FLMGASCGGGNMKVDEEEYQQKGL 1241
            .||...|...|:          :..:||.  :::|....| .|:|.|. ......|.|....|.|
Zfish   210 FTGGVSEMYELR----------KAPRDLY--RIISKALDRGSLLGCSI-DITSAFDMESVTFKKL 261

  Fly  1242 RPRHAYSVLDVKDIQ----GHRLLKLRNPWGHYSWRGDWSDDSSLW-------TDDLRDALMPHG 1295
            ...|||||..:|.::    ..||:::|||||...|.|.|||:|..|       .|||...:    
Zfish   262 VKGHAYSVTALKQVEYRGRMERLIRIRNPWGQVEWTGAWSDNSPEWDEIDPSEKDDLHLQM---- 322

  Fly  1296 ASEGVFWISFEDVLNYFDCIDICKV---------RSGWNEVRLQGT------------------L 1333
             .:|.||:||.:.|..|..::||.:         .|.||.::..|.                  :
Zfish   323 -EDGEFWMSFGEFLRQFSRLEICNLTPDALSDDDMSHWNTIKFHGAWRRGSTAGGCRNHPNTFWI 386

  Fly  1334 QPLCSISCVLLTVLE----PTEAE------FTLFQEGQRNSEKSQRSQLDLCVVIFRTRSPAAPE 1388
            .|...|     |:||    |.:.|      ..|.|:.:|......:....:...|:.     .||
Zfish   387 NPQYKI-----TLLEEDDDPEDEEVACSFLVALMQKDRRRYRGQGQDMHTIGFAIYE-----VPE 441

  Fly  1389 IGRLVEHSKRQVRGFVGCHKM-LERDIYL 1416
                         .:.||..: |::|.:|
Zfish   442 -------------EYTGCQNVHLKKDFFL 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
solNP_476738.3 zf-RanBP 6..34 CDD:279035
RanBP2-type Zn finger 10..29 CDD:275376
zf-RanBP 135..164 CDD:279035
zf-RanBP 643..672 CDD:279035
RanBP2-type Zn finger 647..667 CDD:275375
zf-RanBP 704..731 CDD:279035
RanBP2-type Zn finger 708..727 CDD:275376
zf-RanBP 747..774 CDD:279035
RanBP2-type Zn finger 749..768 CDD:275376
zf-RanBP 927..954 CDD:279035
RanBP2-type Zn finger 931..950 CDD:275376
CysPc 1001..1328 CDD:128526 113/355 (32%)
capn1aNP_956739.1 Peptidase_C2 49..345 CDD:279042 106/323 (33%)
Calpain_III 359..510 CDD:279416 21/122 (17%)
EFh 581..631 CDD:298682
EFh 610..>664 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.