DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sol and Capn7

DIOPT Version :9

Sequence 1:NP_476738.3 Gene:sol / 44014 FlyBaseID:FBgn0003464 Length:1594 Species:Drosophila melanogaster
Sequence 2:NP_001025208.1 Gene:Capn7 / 306260 RGDID:1304855 Length:813 Species:Rattus norvegicus


Alignment Length:446 Identity:123/446 - (27%)
Similarity:187/446 - (41%) Gaps:117/446 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   970 VRVALTPADIRQESKLMENLRQ-LEETEA----LTKWQNIIQYCRDNSELF------VDDSFPPA 1023
            ::.:...||...::||.:..|| |:..||    |||     .:|:..|...      |...||..
  Rat   121 LKTSYETADKTLQNKLKQLARQALDRAEALSEPLTK-----PFCKLKSTNMKTKTPPVRTHFPLG 180

  Fly  1024 PKSL------YYNPASGAGEG-----NPVVQWRRPHEINCDGGAYPPWAV------FRTPLP--- 1068
            |...      :.:|.|...:|     ..:...|...:||  |..|.|:..      |..|:|   
  Rat   181 PNPFLEKPQPFISPQSCDAQGQKYTAEEIEVLRTTSKIN--GAEYVPFMSVDLRERFAYPMPFCD 243

  Fly  1069 ------------------------------------SDICQGVLGNCWLLSALAVLAEREDLVKE 1097
                                                ..|.|.::.:|..:::||:.|..|....:
  Rat   244 RLGKLPLSPKQKATFSKWVRPEDLTNNPTMIYTVSSFSIKQTIVSDCSFVASLAISAAYERRFNK 308

  Fly  1098 VLVTKEICGQ-----------GAYQVRLCKDGKWTTVLVDDLLPCDKRGHLVYSQAKRK-QLWVP 1150
            .|:|..|..|           |.|.|:|..:|....|::||.||.|.:|.|:.|.:..| :|||.
  Rat   309 KLITSIIYPQNKDGEPEYNPCGKYMVKLHLNGVPRKVIIDDQLPVDHKGELLCSYSNNKSELWVS 373

  Fly  1151 LIEKAVAKIHGCYEALVSGRAIEGLATLTGAPCESIPLQASSLPMPSEDELDKDLIWAQLLSSRC 1215
            |||||..|:.|.|:...|...|: |..|||...|.|.:.:.|      ....||..:..|..   
  Rat   374 LIEKAYMKVMGGYDFPGSNSNID-LHALTGWIPERIAMHSDS------QTFSKDSSFRMLYQ--- 428

  Fly  1216 VRF-----LMGASCGGGNMKVDEEEYQQKGLRPRHAYSVLDVKDIQGHRLLKLRNPWGHYSWRGD 1275
             ||     |:.||.|    .:.|.|.::.||.|.|||:|||:::.:|.|.::|:|||.|..|:|.
  Rat   429 -RFHKGDVLITASTG----MMTEAEGEKWGLVPTHAYAVLDIREFKGLRFIQLKNPWSHLRWKGR 488

  Fly  1276 WSD-DSSLWTDDLRDALM--PHGASE---GVFWISFEDVLNYFDCIDICKVRSGWN 1325
            :|: |...||.:|:..|.  |..|.:   |:||||::|:..|:|.:.:     .||
  Rat   489 YSENDVKNWTPELQKYLNFDPRTAQKIDNGIFWISWDDLCQYYDVVYL-----SWN 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
solNP_476738.3 zf-RanBP 6..34 CDD:279035
RanBP2-type Zn finger 10..29 CDD:275376
zf-RanBP 135..164 CDD:279035
zf-RanBP 643..672 CDD:279035
RanBP2-type Zn finger 647..667 CDD:275375
zf-RanBP 704..731 CDD:279035
RanBP2-type Zn finger 708..727 CDD:275376
zf-RanBP 747..774 CDD:279035
RanBP2-type Zn finger 749..768 CDD:275376
zf-RanBP 927..954 CDD:279035
RanBP2-type Zn finger 931..950 CDD:275376
CysPc 1001..1328 CDD:128526 111/410 (27%)
Capn7NP_001025208.1 MIT_calpain7_1 5..76 CDD:239144
MIT 85..157 CDD:412291 12/40 (30%)
CysPc 214..538 CDD:238004 99/345 (29%)
calpain_III 687..810 CDD:214786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111762at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.