| Sequence 1: | NP_476738.3 | Gene: | sol / 44014 | FlyBaseID: | FBgn0003464 | Length: | 1594 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011531857.1 | Gene: | CAPN7 / 23473 | HGNCID: | 1484 | Length: | 829 | Species: | Homo sapiens |
| Alignment Length: | 322 | Identity: | 100/322 - (31%) |
|---|---|---|---|
| Similarity: | 154/322 - (47%) | Gaps: | 65/322 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1043 QWRRPHEINCDGGAYPPWAVFRTPLPSDICQGVLGNCWLLSALAVLAEREDLVKEVLVTKEICGQ 1107
Fly 1108 -----------GAYQVRLCKDG----------------KWTTVLVDDLLPCDKRGHLVYSQAKRK 1145
Fly 1146 -QLWVPLIEKAVAKIHGCYEALVSGRAIEGLATLTGAPCESIPLQASSLPMPSEDELDKDLIWAQ 1209
Fly 1210 LLSSRCVRF-----LMGASCGGGNMKVDEEEYQQKGLRPRHAYSVLDVKDIQGHRLLKLRNPWGH 1269
Fly 1270 YSWRGDWSD-DSSLWTDDLRDALM--PHGASE---GVFWISFEDVLNYFDCIDICKVRSGWN 1325 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sol | NP_476738.3 | zf-RanBP | 6..34 | CDD:279035 | |
| RanBP2-type Zn finger | 10..29 | CDD:275376 | |||
| zf-RanBP | 135..164 | CDD:279035 | |||
| zf-RanBP | 643..672 | CDD:279035 | |||
| RanBP2-type Zn finger | 647..667 | CDD:275375 | |||
| zf-RanBP | 704..731 | CDD:279035 | |||
| RanBP2-type Zn finger | 708..727 | CDD:275376 | |||
| zf-RanBP | 747..774 | CDD:279035 | |||
| RanBP2-type Zn finger | 749..768 | CDD:275376 | |||
| zf-RanBP | 927..954 | CDD:279035 | |||
| RanBP2-type Zn finger | 931..950 | CDD:275376 | |||
| CysPc | 1001..1328 | CDD:128526 | 100/322 (31%) | ||
| CAPN7 | XP_011531857.1 | MIT_calpain7_1 | 5..76 | CDD:239144 | |
| MIT | 85..159 | CDD:294211 | |||
| CysPc | 214..554 | CDD:238004 | 98/319 (31%) | ||
| calpain_III | 703..826 | CDD:214786 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0045 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D111762at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.820 | |||||