DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sol and clp-8

DIOPT Version :9

Sequence 1:NP_476738.3 Gene:sol / 44014 FlyBaseID:FBgn0003464 Length:1594 Species:Drosophila melanogaster
Sequence 2:NP_493327.2 Gene:clp-8 / 185746 WormBaseID:WBGene00009695 Length:646 Species:Caenorhabditis elegans


Alignment Length:641 Identity:155/641 - (24%)
Similarity:276/641 - (43%) Gaps:148/641 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   981 QESKLMENLRQL-------------------EETEALTKWQNIIQYCRDNSELFVDDSFPPAPKS 1026
            ||.:|:|.:.:.                   .|.||..|:::|::.|:.:...|:|..||..|||
 Worm     5 QEEELLELIEKYNEDKYCTNMNWTIFLGDHENEKEANEKFKSILEDCQRSKSAFIDKEFPHEPKS 69

  Fly  1027 -LYYNPAS---GAGEG-----NPVVQWRR----PHEINCDGGAYPPWAVFRTPLPSDICQGVLGN 1078
             :.::..|   |..|.     .|.: |||    ..:::.....|.|    .|....::.|..:|:
 Worm    70 YMTFDEQSKVYGKYESWKTWLFPKI-WRRITPPSTDVSSSLSVYNP----LTFTAYEVFQRKVGD 129

  Fly  1079 CWLLSALAVLAEREDLVKEVLVTKEICGQGAYQVRLCKDGKWTTVLVDDLLPCDKRGHLVYSQAK 1143
            |.|::||:.::.:.:::..:..:.::...|.|:|:|..||:|.|:::||..|....| :......
 Worm   130 CGLVAALSAISTKPEVIMNIFDSLQLSKYGVYKVKLFVDGQWKTIIIDDYFPYTTDG-IRIGATS 193

  Fly  1144 RKQLWVPLIEKAVAKIHGCYEALVSGRAIEGLATLTGAPCESIPLQASSLPMPSEDELDKDLIWA 1208
            ..|:|..|||||:.|..|.|:.:...:::...:.|||:|...||:....      :.|.|  .|.
 Worm   194 GYQIWAALIEKALVKECGNYKGIHGFQSLSAFSALTGSPVLLIPVAKMF------NNLRK--YWK 250

  Fly  1209 QLLSSRCVRFLMGASCGGGNMKVDEEEYQQKGLRPRHAYSVLDVKDIQGHRLLKLRNPWGHYSWR 1273
            .|:..|..::.|  :||..|.:|:       |:.|:|||:::|:.:..||:||.||||.|...|.
 Worm   251 TLMEFRNNQYPM--ACGTLNREVN-------GILPQHAYTIMDIVERDGHKLLLLRNPSGGSVWT 306

  Fly  1274 GDWSDDSSLWTDDLRDALMPHGASEGVFWISFEDVLNYFDCIDICKVRSGW-------------- 1324
            .:||.:...|.::::|.|  .|...|.||||::|.||.|..|.:|:.||.|              
 Worm   307 RNWSKEWEWWPENMKDLL--EGMIRGSFWISWDDFLNVFCSIYVCRHRSNWFAYYAKLVLKYPED 369

  Fly  1325 ---NEVRLQGTLQPLCSISCV---------LLTVLEPTEAEFTLFQEGQR---------NSEKSQ 1368
               ..:.::.|.:.:..||.|         |.||      ||.:.:..||         |...|.
 Worm   370 DAFPAIDIKVTEKCMVCISAVDDWISREVLLKTV------EFQMPKYVQRYSWIAVHKINGIFSD 428

  Fly  1369 RSQLDLCVVIFRTRSPAAPEIGRLVEHSKRQVRGFVGCHKMLERDIYLLVCLAFNHWHTGIEDPH 1433
            ..::..|.:|    :.:..:|.                   ||..||.:..:..|.|.....|  
 Worm   429 NKKVVACEII----NDSTQDID-------------------LEPGIYTITVIYLNDWSLDKRD-- 468

  Fly  1434 QYPQCILAIHSSKRLLVEQ-----ISPSPHL--LADAIISLTLTKGQR--HEGREGMT-AYYLTK 1488
                  ::||||:.:.|.:     ...|.|:  :.|..       ||.  .|.::.|: ..|...
 Worm   469 ------ISIHSSRPISVNEGFSRTRKDSVHIKYIVDKF-------GQEIVKEQKDKMSIKKYTDN 520

  Fly  1489 GWAGLVVMVENRHENKWI--HVKCDCQESYNVVSTRGELKTVDSVPPLQRQVIIVL 1542
            .:..:.|:..|...::::  |::....:...|..:..:.:|||.:||.:.||::|:
 Worm   521 NFTFIAVVAWNFTYDQFLHAHLRYSITDEQFVSRSLEDKQTVDVIPPRRHQVLVVI 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
solNP_476738.3 zf-RanBP 6..34 CDD:279035
RanBP2-type Zn finger 10..29 CDD:275376
zf-RanBP 135..164 CDD:279035
zf-RanBP 643..672 CDD:279035
RanBP2-type Zn finger 647..667 CDD:275375
zf-RanBP 704..731 CDD:279035
RanBP2-type Zn finger 708..727 CDD:275376
zf-RanBP 747..774 CDD:279035
RanBP2-type Zn finger 749..768 CDD:275376
zf-RanBP 927..954 CDD:279035
RanBP2-type Zn finger 931..950 CDD:275376
CysPc 1001..1328 CDD:128526 99/356 (28%)
clp-8NP_493327.2 CysPc 47..350 CDD:238004 95/327 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5116
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111762at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.730

Return to query results.
Submit another query.