DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sol and clp-2

DIOPT Version :9

Sequence 1:NP_476738.3 Gene:sol / 44014 FlyBaseID:FBgn0003464 Length:1594 Species:Drosophila melanogaster
Sequence 2:NP_497964.1 Gene:clp-2 / 175618 WormBaseID:WBGene00000543 Length:805 Species:Caenorhabditis elegans


Alignment Length:307 Identity:100/307 - (32%)
Similarity:154/307 - (50%) Gaps:54/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1044 WRRPHEI--NCDGGAYPPWAVFRTPLPSDICQGVLGNCWLLSALAVLAEREDLVKEVLVTKEICG 1106
            |:|..|:  |       |..:|.....: |.|.|:.:|..:|:|::.|..|...|:.|||..|..
 Worm   266 WKRVSELFEN-------PTIIFSIDCHT-IKQTVISDCSFISSLSIAALYEKRFKKQLVTSIIFP 322

  Fly  1107 Q-----------GAYQVRLCKDGKWTTVLVDDLLPCDKRGHLVYSQAKRK-QLWVPLIEKAVAKI 1159
            |           |.|..:...:|.|..||:||..|.|:...::.||.:.| :|||.|:|||..|:
 Worm   323 QDANGKPIYNPAGKYMFKFHLNGAWRKVLIDDYFPVDENNRMMCSQTENKGELWVSLLEKAYMKV 387

  Fly  1160 HGCYEALVSGRAIEGLATLTGAPCESIPLQASSLPMPSEDELDKDLIWAQLLSSRCVRF-----L 1219
            .|.|:...|...|: |..|||...|.|.|..:|       :.|.|.::.:|..    ||     |
 Worm   388 MGGYDFPGSNSNID-LNALTGWIPERIELSDTS-------KADPDEVFRKLFD----RFHRGDCL 440

  Fly  1220 MGASCGGGNMKVDEEEYQQKGLRPRHAYSVLDVKDIQGHRLLKLRNPWGHYSWRGDWSD-DSSLW 1283
            :..:.|    |:.|:..::.||...|||:|:|::.::..||||::|||.|..|:|::|| |...|
 Worm   441 ITLATG----KMTEDMQKRSGLVETHAYAVIDIRCVETKRLLKVKNPWTHSRWKGNFSDKDKVNW 501

  Fly  1284 TDDLRDALM--PHGASE---GVFWISFEDVLNYFDCIDICKVRSGWN 1325
            |..:::||.  |..|:|   |:|||.:|.|.::||.|.:     .||
 Worm   502 TAKMKNALAFDPEVAAEKDDGIFWIDYESVRHFFDVIYV-----NWN 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
solNP_476738.3 zf-RanBP 6..34 CDD:279035
RanBP2-type Zn finger 10..29 CDD:275376
zf-RanBP 135..164 CDD:279035
zf-RanBP 643..672 CDD:279035
RanBP2-type Zn finger 647..667 CDD:275375
zf-RanBP 704..731 CDD:279035
RanBP2-type Zn finger 708..727 CDD:275376
zf-RanBP 747..774 CDD:279035
RanBP2-type Zn finger 749..768 CDD:275376
zf-RanBP 927..954 CDD:279035
RanBP2-type Zn finger 931..950 CDD:275376
CysPc 1001..1328 CDD:128526 100/307 (33%)
clp-2NP_497964.1 MIT 4..75 CDD:239121
CysPc 227..551 CDD:128526 100/307 (33%)
Calpain_III <722..801 CDD:381833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111762at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.