DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sol and Capn9

DIOPT Version :9

Sequence 1:NP_476738.3 Gene:sol / 44014 FlyBaseID:FBgn0003464 Length:1594 Species:Drosophila melanogaster
Sequence 2:NP_001258069.1 Gene:Capn9 / 116694 RGDID:70965 Length:690 Species:Rattus norvegicus


Alignment Length:516 Identity:142/516 - (27%)
Similarity:211/516 - (40%) Gaps:111/516 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1001 WQNIIQYCRDNSELFVDDSFPPAPKSLYYNPASGAGEGNPVVQWRRPHEI--NCD---GGAYPPW 1060
            ::.:.|.|..:..||.|..||.:..||:|:.....    |.| |:||.||  |.:   |||    
  Rat    29 FEQLRQSCLQSGTLFEDADFPASNSSLFYSERPQV----PFV-WKRPGEIVENPEFILGGA---- 84

  Fly  1061 AVFRTPLPSDICQGVLGNCWLLSALAVLAEREDLVKEVLVTKEICGQ---GAYQVRLCKDGKWTT 1122
              .||    |||||.||:||||:|:|.|...:..:..|:...:..|.   |.:..:..:..:|..
  Rat    85 --TRT----DICQGELGDCWLLAAIASLTLNQKALARVVPQDQGFGSGYAGIFHFQFWQHSEWLD 143

  Fly  1123 VLVDDLLPCDKRGHLVY-SQAKRKQLWVPLIEKAVAKIHGCYEALVSGRAIEGLATLTGAPCESI 1186
            |::||.|| ..|..||: ..|...:.|..|:|||.||::|.||||..|.|||.:...||...|: 
  Rat   144 VVIDDRLP-TFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAEN- 206

  Fly  1187 PLQASSLPMPSEDELDKDLIWAQLLSSRCVRFLMGASCGGGNMKVDEEEYQQK-GLRPRHAYSV- 1249
             .|....|....:.|:|.|....||           .|....:...|.|.:.. ||...|||:| 
  Rat   207 -FQIREAPEDFYEILEKALRRGSLL-----------GCSIDTLNASESEARTPLGLIKGHAYTVT 259

  Fly  1250 -LDVKDIQGHR--LLKLRNPWGHYSWRGDWSDDSSLWTD---DLRDALMPHGASEGVFWISFEDV 1308
             ||..:..|.|  |:::|||||...|.|.|||.|..|..   :.:..|......:|.||::|||.
  Rat   260 GLDQVNFHGQRIKLIRVRNPWGQVEWNGPWSDSSPEWRSMSLEEQKRLGHTALDDGEFWMAFEDF 324

  Fly  1309 LNYFDCIDICKVRSG---------WNEVRLQGT-------------LQPLCSISCVLLTVLEPTE 1351
            ..:||.::||.:...         |.....||:             |....:...:.|::.|..|
  Rat   325 KTHFDKVEICNLTPDALEDNTLHKWEVTIHQGSWVRGSTAGGCRNFLDTFWTNPQIKLSLTERDE 389

  Fly  1352 AE------FTLFQEGQRNSEKSQRSQLDLCVVIFRTRSPAAPEIGRLVEHSKRQVRGFVGCHKML 1410
            .:      ..|.|:.:|..::...:.|.:...|::    ...:.|.|       .|.|...|..|
  Rat   390 GQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQ----CPDKDGHL-------NRDFFRYHASL 443

  Fly  1411 ERD------------------IYLLVCLAFNHWHTGIEDPHQYPQCILAIHSSKRLLVEQI 1453
            .|.                  .|:|:...|        :|||.....|.|.|.|:.:.:.:
  Rat   444 ARSKTFINLREVSGRFQLPPGDYILIPSTF--------EPHQEADFCLRIFSEKKAVTQDL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
solNP_476738.3 zf-RanBP 6..34 CDD:279035
RanBP2-type Zn finger 10..29 CDD:275376
zf-RanBP 135..164 CDD:279035
zf-RanBP 643..672 CDD:279035
RanBP2-type Zn finger 647..667 CDD:275375
zf-RanBP 704..731 CDD:279035
RanBP2-type Zn finger 708..727 CDD:275376
zf-RanBP 747..774 CDD:279035
RanBP2-type Zn finger 749..768 CDD:275376
zf-RanBP 927..954 CDD:279035
RanBP2-type Zn finger 931..950 CDD:275376
CysPc 1001..1328 CDD:128526 114/352 (32%)
Capn9NP_001258069.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Peptidase_C2 43..335 CDD:279042 109/320 (34%)
Domain III 338..521 29/178 (16%)
Calpain_III 349..491 CDD:279416 29/160 (18%)
Domain IV 522..690
EFh 566..621 CDD:238008
EF-hand_7 597..652 CDD:290234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.