DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sol and CAPN10

DIOPT Version :9

Sequence 1:NP_476738.3 Gene:sol / 44014 FlyBaseID:FBgn0003464 Length:1594 Species:Drosophila melanogaster
Sequence 2:NP_075571.2 Gene:CAPN10 / 11132 HGNCID:1477 Length:672 Species:Homo sapiens


Alignment Length:582 Identity:147/582 - (25%)
Similarity:227/582 - (39%) Gaps:175/582 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1013 ELFVDDSFPPAPKSLYYNPASGAGEGNPVVQWRRPHEINCDGGAYPPWAVFRTPLPSDICQGVLG 1077
            |||.|.:||.|..||:.:.::...:....:.||||.||......:|.     .|....:.||:||
Human    12 ELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEICATPRLFPD-----DPREGQVKQGLLG 71

  Fly  1078 NCWLLSALAVLAEREDLVKEVLVTKEICGQ---------GAYQVRLCKDGKWTTVLVDDLLPCDK 1133
            :||.|.|.|.|.:...|:.:|:..    ||         |::..|:.:.|:|..|..||.||| .
Human    72 DCWFLCACAALQKSRHLLDQVIPP----GQPSWADQEYRGSFTCRIWQFGRWVEVTTDDRLPC-L 131

  Fly  1134 RGHLVYSQAKRKQL-WVPLIEKAVAKIHGCYEALVSGRAIEGLATLTGAPCESIPLQASSLPMPS 1197
            .|.|.:|:.:|:.: |:||:||..||:||.||.|.:|:..:.|..|||...|...|:..:   .|
Human   132 AGRLCFSRCQREDVFWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGGLAERWNLKGVA---GS 193

  Fly  1198 EDELDKDLIWA------------QLLSSRCVRFLMGASCGGGNMKVDEEEYQQKGLRPR------ 1244
            ..:.|:...|.            |.|.|.||                        |.||      
Human   194 GGQQDRPGRWEHRTCRQLLHLKDQCLISCCV------------------------LSPRAGAREL 234

  Fly  1245 ---HAYSVLDVKDIQGHR-----LLKLRNPWGHYSWRGDWSDDSSLWT-------DDLRDALMPH 1294
               ||:.|.|::::||..     ||:::||||...|:|.|.:....|:       .:|...|   
Human   235 GEFHAFIVSDLRELQGQAGQCILLLRIQNPWGRRCWQGLWREGGEGWSQVDAAVASELLSQL--- 296

  Fly  1295 GASEGVFWISFEDVLNYFDCIDI-------------------CKVRS---GWNEVRLQGTLQPLC 1337
              .||.||:..|:.|..||.:.:                   |..|:   .|    ::|.....|
Human   297 --QEGEFWVEEEEFLREFDELTVGYPVTEAGHLQSLYTERLLCHTRALPGAW----VKGQSAGGC 355

  Fly  1338 -------SISCVLLTVLEPTEAEFTLFQEGQRNSEKSQRSQLDLCVVIFRTR----------SPA 1385
                   |.....|.|.||:|....:.          |||:|.......|.|          |||
Human   356 RNNSGFPSNPKFWLRVSEPSEVYIAVL----------QRSRLHAADWAGRARALVGDSHTSWSPA 410

  Fly  1386 A------PEIG-RLVEHSKRQVR----------GFVGCHKMLERDIYLLVCLAFNHW----HTGI 1429
            :      ..:| .|.:..||:|.          ....|| ..:|:::|...|:..::    .|.:
Human   411 SIPGKHYQAVGLHLWKVEKRRVNLPRVLSMPPVAGTACH-AYDREVHLRCELSPGYYLAVPSTFL 474

  Fly  1430 ED-PHQYPQCILAIHSSKRLLVEQI-------SPSPHLLADAIISLTLTKGQRHEGREGMTA 1483
            :| |.::   :|.:.|:.|:.:..|       :|...|.|....::.|    |...|.|.||
Human   475 KDAPGEF---LLRVFSTGRVSLSAIRAVAKNTTPGAALPAGEWGTVQL----RGSWRVGQTA 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
solNP_476738.3 zf-RanBP 6..34 CDD:279035
RanBP2-type Zn finger 10..29 CDD:275376
zf-RanBP 135..164 CDD:279035
zf-RanBP 643..672 CDD:279035
RanBP2-type Zn finger 647..667 CDD:275375
zf-RanBP 704..731 CDD:279035
RanBP2-type Zn finger 708..727 CDD:275376
zf-RanBP 747..774 CDD:279035
RanBP2-type Zn finger 749..768 CDD:275376
zf-RanBP 927..954 CDD:279035
RanBP2-type Zn finger 931..950 CDD:275376
CysPc 1001..1328 CDD:128526 104/379 (27%)
CAPN10NP_075571.2 CysPc 2..319 CDD:238004 101/348 (29%)
Domain III 1 322..494 36/189 (19%)
Calpain_III 335..496 CDD:238132 36/178 (20%)
Calpain_III 512..653 CDD:238132 6/22 (27%)
Domain III 2 513..654 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.