DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sol and CAPN9

DIOPT Version :9

Sequence 1:NP_476738.3 Gene:sol / 44014 FlyBaseID:FBgn0003464 Length:1594 Species:Drosophila melanogaster
Sequence 2:XP_011542319.1 Gene:CAPN9 / 10753 HGNCID:1486 Length:721 Species:Homo sapiens


Alignment Length:525 Identity:143/525 - (27%)
Similarity:217/525 - (41%) Gaps:114/525 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1001 WQNIIQYCRDNSELFVDDSFPPAPKSLYYNPASGAGEGNPVVQ--WRRPHEI--NCD---GGAYP 1058
            ::.:.|.|.....||.|..||.:..||:|:.       .|.:.  |:||.||  |.:   |||  
Human    29 FEQMRQECLQRGTLFEDADFPASNSSLFYSE-------RPQIPFVWKRPGEIVKNPEFILGGA-- 84

  Fly  1059 PWAVFRTPLPSDICQGVLGNCWLLSALAVLAEREDLVKEVLVTKEICG---QGAYQVRLCKDGKW 1120
                .||    |||||.||:||||:|:|.|...:..:..|:...:..|   .|.:..:..:..:|
Human    85 ----TRT----DICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFGPGYAGIFHFQFWQHSEW 141

  Fly  1121 TTVLVDDLLPCDKRGHLVY-SQAKRKQLWVPLIEKAVAKIHGCYEALVSGRAIEGLATLTGAPCE 1184
            ..|::||.|| ..|..||: ..|...:.|..|:|||.||::|.||||..|.|||.:...||...|
Human   142 LDVVIDDRLP-TFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAE 205

  Fly  1185 SIPLQASSLPMPSEDELDKDLIWAQLLSSRCVRFLMGASCGGGNMKVDEEEYQQKGLRPRHAYSV 1249
            :  .|....|....:.|:|.|....||.  |  |:...|.      .:.|.....||...|||||
Human   206 T--FQTKEAPENFYEILEKALKRGSLLG--C--FIDTRSA------AESEARTPFGLIKGHAYSV 258

  Fly  1250 --LDVKDIQGHR--LLKLRNPWGHYSWRGDWSDDSSLW--TDDLRDALMPHGA-SEGVFWISFED 1307
              :|....:|.|  |:::|||||...|.|.|||.|..|  ........:.|.| .:|.||::|:|
Human   259 TGIDQVSFRGQRIELIRIRNPWGQVEWNGSWSDSSPEWRSVGPAEQKRLCHTALDDGEFWMAFKD 323

  Fly  1308 VLNYFDCIDICKVRSG---------WNEVRLQGT-------------LQPLCSISCVLLTVLEPT 1350
            ...:||.::||.:...         |.....||:             |....:...:.|::.|..
Human   324 FKAHFDKVEICNLTPDALEEDAIHKWEVTVHQGSWVRGSTAGGCRNFLDTFWTNPQIKLSLTEKD 388

  Fly  1351 EAE------FTLFQEGQRNSEKSQRSQLDLCVVIFRTRSPAAPEIGRLVEH----------SKRQ 1399
            |.:      ..|.|:.:|..::...:.|.:...|:.     .|:..   ||          |:.:
Human   389 EGQEECSFLVALMQKDRRKLKRFGANVLTIGYAIYE-----CPDKD---EHLNKDFFRYHASRAR 445

  Fly  1400 VRGFVGCHKMLER-----DIYLLVCLAFNHWHTGIEDPHQYPQCILAIHSSKRLLVEQIS----- 1454
            .:.|:...::.:|     ..|:|:...|        :|||.....|.|.|.|:.:...:.     
Human   446 SKTFINLREVSDRFKLPPGEYILIPSTF--------EPHQEADFCLRIFSEKKAITRDMDGNVDI 502

  Fly  1455 --PSP 1457
              |.|
Human   503 DLPEP 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
solNP_476738.3 zf-RanBP 6..34 CDD:279035
RanBP2-type Zn finger 10..29 CDD:275376
zf-RanBP 135..164 CDD:279035
zf-RanBP 643..672 CDD:279035
RanBP2-type Zn finger 647..667 CDD:275375
zf-RanBP 704..731 CDD:279035
RanBP2-type Zn finger 708..727 CDD:275376
zf-RanBP 747..774 CDD:279035
RanBP2-type Zn finger 749..768 CDD:275376
zf-RanBP 927..954 CDD:279035
RanBP2-type Zn finger 931..950 CDD:275376
CysPc 1001..1328 CDD:128526 114/353 (32%)
CAPN9XP_011542319.1 Peptidase_C2 43..335 CDD:279042 109/321 (34%)
Calpain_III 349..491 CDD:279416 28/157 (18%)
PTZ00184 514..657 CDD:185504
EFh 566..621 CDD:238008
EFh 600..652 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.