DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sol and capn8.3

DIOPT Version :9

Sequence 1:NP_476738.3 Gene:sol / 44014 FlyBaseID:FBgn0003464 Length:1594 Species:Drosophila melanogaster
Sequence 2:XP_031758475.1 Gene:capn8.3 / 100498169 XenbaseID:XB-GENE-18006552 Length:700 Species:Xenopus tropicalis


Alignment Length:533 Identity:134/533 - (25%)
Similarity:211/533 - (39%) Gaps:146/533 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1008 CRDNSELFVDDSFPPAPKSL---YYNPASGAGEGNPVVQWRRPHEINCDGGAYP-PWAVFRTPLP 1068
            |..::.||.|:.||.:..||   ...|.|...:|   :.|.||.:|      :| |..:......
 Frog    39 CLASNSLFEDEPFPASQASLGVKELGPDSDKTKG---IVWLRPMQI------HPKPEFIISGATR 94

  Fly  1069 SDICQGVLGNCWLLSALAVLAEREDLVKEVLVTKEICGQ--------GAYQVRLCKDGKWTTVLV 1125
            |||.||.||:||.||::|.|...|:.:.:|     :.|.        |.:..:..:.|:|..|:|
 Frog    95 SDIRQGSLGDCWFLSSIASLTLNEEYLSQV-----VPGDQSFQTNYAGIFHFKFWQYGEWVDVVV 154

  Fly  1126 DDLLPCDKRGHLVY-SQAKRKQLWVPLIEKAVAKIHGCYEALVSGRAIEGLATLTGAPCESIPLQ 1189
            ||.|| .|:|.||: ..|:..:.|..|:|||.||::|.||||:.|..::.|...||...|...|:
 Frog   155 DDRLP-TKKGKLVFVKSAEGNEFWSALLEKAYAKLNGSYEALIGGSPVDALEDFTGGIAELYYLE 218

  Fly  1190 ASSLPMPSEDELDKDLIWAQLLSSRCVRFLMGAS---CGGGNMKVDEEEYQQKGLRPRHAYSVLD 1251
                 .|..|           |..|..:.|...|   |...:.....|...:..:...|||::..
 Frog   219 -----KPPAD-----------LFQRVQKVLRANSLLTCSSKSDSGKVETVAKNNVVKNHAYTITR 267

  Fly  1252 VKDI--QGHR--LLKLRNPWGHYSWRGDWSDDSSLWTD---DLRDALMPHGASEGVFWISFEDVL 1309
            .:::  :|.:  |::||||||...|.|.|||::..|.|   :.|.||...| .:|..|:.|.|.:
 Frog   268 AEEVSYRGEKVQLIRLRNPWGKTEWNGAWSDNAPEWDDIDSETRAALNTQG-DDGEVWMPFSDFI 331

  Fly  1310 NYFDCIDIC---------KVRSGWNEVRLQGTLQPLCSI-SC------------VLLTVLEPTEA 1352
            :.|..:|||         |....|...:..|:.:..|:. .|            ..:.:.||   
 Frog   332 SEFYRLDICNLSLDCVCSKEERRWCLTQFYGSWKSGCTAGGCKKYPDTFWINPQFRIKLEEP--- 393

  Fly  1353 EFTLFQEGQRNSEKSQRSQLDLCVVIF-------RTRSPAAPE---IGRLVEHSKRQVRG----- 1402
                  :.:|.:.|:|.     |.||.       |...|...|   :|..:....::::|     
 Frog   394 ------DDERGAGKAQS-----CTVIVALIQKNRRKMKPTGGEEFAVGYYLYPIPKELQGSPDVP 447

  Fly  1403 ----------FVG------------CHKMLERDIYLLVCLAFNHWHTGIEDPHQYPQC-----IL 1440
                      :|.            |...|....|:|:             ||.|..|     .|
 Frog   448 LGKDFFLKTKYVAWTDVYKKHRETCCRHKLPVGEYVLL-------------PHTYYPCQEADFCL 499

  Fly  1441 AIHSSKRLLVEQI 1453
            .:.|.|::.|.::
 Frog   500 RVFSEKKVGVWEL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
solNP_476738.3 zf-RanBP 6..34 CDD:279035
RanBP2-type Zn finger 10..29 CDD:275376
zf-RanBP 135..164 CDD:279035
zf-RanBP 643..672 CDD:279035
RanBP2-type Zn finger 647..667 CDD:275375
zf-RanBP 704..731 CDD:279035
RanBP2-type Zn finger 708..727 CDD:275376
zf-RanBP 747..774 CDD:279035
RanBP2-type Zn finger 749..768 CDD:275376
zf-RanBP 927..954 CDD:279035
RanBP2-type Zn finger 931..950 CDD:275376
CysPc 1001..1328 CDD:128526 105/351 (30%)
capn8.3XP_031758475.1 Peptidase_C2 46..341 CDD:395523 100/326 (31%)
Calpain_III 362..502 CDD:395848 26/166 (16%)
EFh_PEF 533..700 CDD:355382
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.