DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sls and Hmcn1

DIOPT Version :10

Sequence 1:NP_001261304.1 Gene:sls / 44013 FlyBaseID:FBgn0086906 Length:18468 Species:Drosophila melanogaster
Sequence 2:XP_006529820.1 Gene:Hmcn1 / 545370 MGIID:2685047 Length:5658 Species:Mus musculus


Alignment Length:5260 Identity:1069/5260 - (20%)
Similarity:1679/5260 - (31%) Gaps:1820/5260 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 DIS-PPVFEQIFKNARFAQGGNALFEGRLRGNPKPFVTWTRKGAP--LLESQKFRMSYNEATGDV 144
            |:| ||...|:..|.....|..|:....:.......:||.|.|..  |.:|.:.|...|     :
Mouse   515 DVSEPPPIIQLPNNVTVTPGERAVLACLVISAVDYNLTWQRSGRDIRLADSARIRTLAN-----L 574

  Fly   145 SLLINQIGPGDEGEYTCTARNQYGEAICSVYIQPEGAPMPALQPIQNLEKNIYSNGYSYTSIEEE 209
            ||.:..:..||.|||.|...::.|.|..||::                            :::|:
Mouse   575 SLELRSVKIGDAGEYRCVVSSEGGSAAASVFL----------------------------TVQEK 611

  Fly   210 FRVDTFEYRLLREVSFREAITRRSGYEQDSQLSQELDRNQGPAQAPQISQKPRSSKLIEGSDAVF 274
                                                         |:::..|::.....||:...
Mouse   612 ---------------------------------------------PKVTVMPKNQSFTGGSEISI 631

  Fly   275 TARVGSNPKPRLTWFHNGQRLVASQKYEISYSSGVATLRVKNATARDGGHYTLLAENLQGCVVSS 339
            .......|||::.|..|...::.|.:|.:: |.|  ||.:|||..:|.|.|..||.|..|....:
Mouse   632 MCSATGYPKPKIVWTMNEMFIMGSHRYRMT-SEG--TLFIKNAVPKDAGTYACLASNAAGTDKQT 693

  Fly   340 AVLAVEPAAETAYEPKPVDVMAEQLEAGKALPPAFVKAFGDREITEGRMTRFDCRVTGNPYPEVF 404
            :.|....|      ||   ::.||.|        .:.|.||..:.|       |:.:|.|.|:|.
Mouse   694 STLRYIEA------PK---LVVEQSE--------LLVALGDTTVME-------CKTSGIPPPQVK 734

  Fly   405 WLINGRQVRDDASHKI--LVNESGSHSLMITNVTRLDAGAVQCLARNKAGEVAIEAQLNVLEKEQ 467
            |.....::|......|  ||.     .|.|.....||||...|:|.|:||.......|:|..   
Mouse   735 WFKGDLELRPSTFLSIDPLVG-----LLKIQETQDLDAGDYTCVAINEAGRATGRLTLDVGS--- 791

  Fly   468 VVAPQFVQRFSTMTVREGEPITMSANAIGTPQPRITWQK-DGVQISST--AERFVG-IDGGATCL 528
              .|.|:|..|.:.|..|..:|:.....|.|:|:|.|:: |.:.:.|.  :..|:. :..||  |
Mouse   792 --PPVFIQEPSDVAVEIGSNVTLPCYVQGYPEPKIKWRRLDNMPVFSRPFSVSFISQLRTGA--L 852

  Fly   529 EIPRVTANDAGWYQCTAQNIAGSTANRARLYV---------------EVPREQPNYEQRRLNLPR 578
            .|..:.|:|.|.|.|.|:|..|...::..:.|               .|...||        |..
Mouse   853 FISNLWASDKGTYICEAENQFGKIQSQTTVTVTGLVAPLIGISPSMASVIEGQP--------LTL 909

  Fly   579 PTKVIEPEPIP-------------GPEIIYLR----HVERAKPHLR------------PGEEDRV 614
            |..::...|||             .|.|....    |:||.:  |:            .|..::.
Mouse   910 PCTLLAGNPIPERRWMKNSAMLVQNPYITVRSDGSLHIERVR--LQDGGKYTCVASNVAGTNNKT 972

  Fly   615 YPPPQFIIP-LQNVQQ----TEGGRVHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGF 674
            ......::| :|:.||    .||..|.:..|...:..|:  :.|...|..::.|:...|....| 
Mouse   973 TSVAVHVLPSIQHGQQILSTIEGVPVTLPCRASGIPKPS--ITWSKKGELISTSSAKFSAGADG- 1034

  Fly   675 IALDLLSIMGHDSGEYMCRVTNASGVAESRAILSVVQRPSIEQSSQNPNSLQYINQLEDYSRYQR 739
             :|.::|....:||||:|..|||:|.|:.:..|:|..||.:               ..|.....:
Mouse  1035 -SLYVVSPGSEESGEYICTATNAAGYAKRKVQLTVYVRPRV---------------FGDQRGLSQ 1083

  Fly   740 TESIDEQLNQAPQFIRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIF 804
            .:.::..:....:.|.|.       |.|::           |...:.|.||...|:..|......
Mouse  1084 DKPVEISVLAGEEAILPC-------EAKSL-----------PPPIITWAKDSQLISPFSPRHTFL 1130

  Fly   805 NFGYVSLNILHLRAEDAGTYTVRAVNRIGEAISQSSIRVHSRSQVTADLGIPEQQRYIEKVEELE 869
            ..|  |:.|...|..|:|.|...|.|..|.......:.||          :|.:.::        
Mouse  1131 PSG--SMKITETRVSDSGMYLCVATNIAGNVTQSVKLSVH----------VPPKIQH-------- 1175

  Fly   870 DYRKSQQRRHVQEAAEAIAPPQFKTPIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQP-L 933
                  ..||:            |..:..::|:..:||          |.....:.|.|.|:| |
Mouse  1176 ------GNRHI------------KVQVGQRVDILCNAH----------GSPPPVITWFKSGRPFL 1212

  Fly   934 EASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQDTTVAQLTVISKNEIVSESQHPGGL 998
            :.:....:...    .|:|:|..|.|||.|||.|.|..|.|          :.|:....|.|..:
Mouse  1213 DGAQHPGSPDG----TLSIEQAVISDAGVYTCAATNIAGSD----------EAEVTLHVQEPPSV 1263

  Fly   999 QKIQHLEDSSRYGRREEEETYITQAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGLVIEWYHN 1063
            :.:|...::      ..:|....|...|..|.|||.|              |      .|:|.||
Mouse  1264 EDLQPPFNT------PFQERLANQRIEFPCPAKGTPK--------------P------TIKWLHN 1302

  Fly  1064 GRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQATMIVETRSSIDTSSMH 1128
            ||.:|......:..:.| ..|.|:.|...:.|.|:.||.|:.|..:::..:.|..          
Mouse  1303 GREVTGQEPGVSILEDG-ALLVIASVTPHNNGEYICVAVNEAGTTERKYNLKVHV---------- 1356

  Fly  1129 RGLYEKTQNLENKPFVEPQYDIEEISKSKPVFVTPLSDPKPIHDGKNIHLECRLEPMGDPTMRVE 1193
                        .|.:..:..:..:|    |..:.|:.           |.|.:|  |.|:..:.
Mouse  1357 ------------PPVIRDKEHVTNVS----VLTSQLAS-----------LYCEVE--GTPSPVIT 1392

  Fly  1194 WFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTDVVT 1258
            |:.:...||..|..:...: |.: |.:.|.:|.|:|.|:.:|.|..||:.....|.|:....::.
Mouse  1393 WYKDDIQVTESSTVQIVNN-GKI-LKLFKVSAEDAGRYSCKAINIAGTSQKDFSVNVLVPPSILG 1455

  Fly  1259 ETQNEQSLEQIQLLEDSRRRHHQEEDITIMQAPQFTRGLHNIETIEGTNVHLECRLQPVGDPSMR 1323
            .:...:                                   :..:...||.|:|  ...|.|...
Mouse  1456 ASSPSE-----------------------------------VSVVLNHNVTLQC--PGTGVPFPA 1483

  Fly  1324 IEWFVNGKPVKTGHRFRPAYEFD--YVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKN 1386
            |.||.:|||:..|.   |..|..  ..:|.|......|.|.|.|...|..|:......:.:    
Mouse  1484 IHWFKDGKPLFLGD---PNIELSDRGQSLHLRNARRSDKGRYQCTVSNAAGKQAKDIKLTV---- 1541

  Fly  1387 DLILETQNESGLQKIQYLEDSTRHRR-----SEFVDEVVNIRPRFLTHPKSLTNTREGGHAHFEC 1446
                            |:..|.:...     |..::.:|.:                      ||
Mouse  1542 ----------------YVPPSIKGGNITTEISALLNSIVKL----------------------EC 1568

  Fly  1447 KIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQ 1511
            :...:..|  .:.|:|:|:.:|...:...| |.|.: |.|......||..|||.|.|:.|:.|..
Mouse  1569 ETRGLPVP--AITWYKDGQVVTSSSQALYI-DKGQL-LHIQRAQVSDSATYTCHAANVAGTAEKS 1629

  Fly  1512 VELQCRSGEQIVTVTQNEAGLEQIHYLEDRSRYTRREEIDESTKQAPVFTTSLKNVEIKENQRAH 1576
            ..:      .|......|..|                             |:..|.::...|...
Mouse  1630 FHV------DIYVPPTIEGDL-----------------------------TAPSNKQVIIGQSLI 1659

  Fly  1577 FECRLIPVSDPSMRVEWYHNNLPLKSGSRFTETNNF----GFVALDIMSTLPEDAGTYTCRAYNA 1637
            .||:  ...:|...:.|..:.:|:|:      ::|.    |...|:|:|.|..|.|.|.|.|.:.
Mouse  1660 LECK--AAGNPPPILTWLKDGVPVKA------SDNIHIEAGGKKLEILSALEVDRGQYICVATSV 1716

  Fly  1638 VGEAITSAVAVVHTKKSIYLESQHETAL---PRLQHLEDGSKRQRISVQDEFVSQAPVFTMPVRD 1699
            .||.                |.::|..:   |.::..|:.|         .|:            
Mouse  1717 AGER----------------EIKYEVDVLVPPAVEGGEETS---------YFI------------ 1744

  Fly  1700 VRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTTTMHDFGY-VALN-----MKYVNPE 1758
              |..|..:..:.::  .|.|..|:.||:.||.|:..:        |: :.||     :......
Mouse  1745 --VLANNLLELDCQV--SGSPPPTIMWLKGGQLIDERD--------GFKILLNGRKLVIAQAQVS 1797

  Fly  1759 DSGTYTCRAVNELGQAVTSASLIVQSKTSIQLETQHEAAMHKIHQLEDHSRYQRREEEEYTVTTA 1823
            |:|.|.|.|.|..|                                 ||     |:|.|.||...
Mouse  1798 DTGLYQCVATNIAG---------------------------------DH-----RKEFEVTVHVP 1824

  Fly  1824 PVFVTKLIGPSNLVEGQSAHYECRIEPYPDPNLKVEWFHNGKPLSTGH----------------- 1871
            |...:..:....:|..:....:|.....|:|:  :.|..:.:|::|.|                 
Mouse  1825 PTIKSSDLPEKTVVRYKPVTLQCIANGIPNPS--ITWLKDDQPVNTAHGNLKDLDADSGPRRRGK 1887

  Fly  1872 ---RFRT---TYDFGFAALDILTVYAEDSGEYTCRVTNNLGEAINSIVLNVTSRSSIIHETQHEE 1930
               |:.|   :.......|.|.....||:|.|||..||..|||.....|:|           ||.
Mouse  1888 EDRRWHTAVASIQSSGRVLQIAKALLEDAGRYTCVATNAAGEAHQHTQLHV-----------HEP 1941

  Fly  1931 ALTKIQHLEDTSRFQRKTDEEQFHAERPQFGRPLRNAKVNEGAPVHLEATLIPVNDPTMKVEWYC 1995
                 ..|:|..:                    :||..|....|:.||..  ....|...:.||.
Mouse  1942 -----PSLDDAGK--------------------MRNETVVVNNPIQLECK--ATGKPLPVITWYK 1979

  Fly  1996 NGRPIQTGHRFKTTYDFGFVALDILYAHAEDTGTYMCKAKNAIGE-------------------- 2040
            :..|: :|.........|.| |:|..|...|.|.|.|.|.|:.|.                    
Mouse  1980 DSHPL-SGSASAAFLKRGQV-LEIGSAQISDAGIYKCVAINSAGATELFYSLQVHVPPSISGSSS 2042

  Fly  2041 -------------------------------------------------AVT----------TC- 2045
                                                             |:|          || 
Mouse  2043 MVEVVVNNLARLECEARGIPAPSLTWLKDGSPVSSFSNGIQILSGGRILALTSAQMSDAGRYTCV 2107

  Fly  2046 AVNVTANKTLDLDTLDAQRLEKIRQLETYAPPPKPVVEEKGQKPIFLTPLSNLEHLKEGEHAHLE 2110
            |||....|..|:|            |..||||  .::.|:....:.:           |:...|.
Mouse  2108 AVNAAGEKQRDID------------LRVYAPP--NIMGEEQNVSVLI-----------GQAVELF 2147

  Fly  2111 CRVEPINDPNLKIEWFCNGKQLPTGHRYRTTHDFGYVALDILYVYGEDTGTYICKATNQLGEAVN 2175
            |:.:.:..|.|.  |..:|:.|........:.: |.| |.|......|||.|.|:|||..|:...
Mouse  2148 CQSDAVPPPTLM--WLKDGRPLLKRPGLSISEN-GSV-LKIEDAQAGDTGRYTCEATNVAGKTEK 2208

  Fly  2176 TCNVRVLNRRSMILDTQHPDALEKIQKLESKVPNARTEVGDAPISPPHFTAELRGSTEIYEGQTA 2240
            ..||.|....|:    ...|.|.::..:|..:.....|....|  ||..|.:.:||..:.:    
Mouse  2209 NYNVNVWVPPSI----YGSDELVQLTAIEGNLITLLCESSGIP--PPDLTWKKKGSLVLAD---- 2263

  Fly  2241 HFEAQVAPVHDPNLRIEFYHNGKPLPSASRFHITFDFGYVSLDITHAVAEDAGEYSVRAVNALGQ 2305
                                      ||.|.||.  .|...|.|:.|...|||.|:..|.|..|.
Mouse  2264 --------------------------SAGRVHIL--SGGRRLQISIAEKADAGLYTCVASNVAGV 2300

  Fly  2306 AVSSTNLRVIPRGTIISDTQHPEGLEKIRKLESTAPHQRQEPETPGTRQRPVFTQPLQNIDRINE 2370
            |....||:|..|.:|.:...|                            ||..|        :..
Mouse  2301 AKKEYNLQVYIRPSITNSGGH----------------------------RPEIT--------VIR 2329

  Fly  2371 HQTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQH-----DFGFVSLDISHIRKEDEGVYM 2430
            .::...|..:  .|.|...|.|      ::|...:||..     |.|.: |.:.::...|.|.|:
Mouse  2330 GKSISLECEV--QGIPQPTVTW------MKDGRPLTKGKGVEILDEGRI-LQLKNVHVSDTGRYV 2385

  Fly  2431 CRAVNPLGEAVTTASMRVVSEASIQMDTQHPDSISRIHQLEKPLAPRPTEPERLFEKPIFTQLLT 2495
            |.|||..|.......:.|.:..||..:...|:::|.:.:....|.                    
Mouse  2386 CVAVNVAGMTDKRYDLSVHAPPSIIGNHGVPENVSVVEKSSVSLT-------------------- 2430

  Fly  2496 GPSELWEGTHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGV 2560
                        .||..:|:  ||:  .|..:|..:.:||.::...  |...|.:....|||||.
Mouse  2431 ------------CEASGIPL--PSI--TWLKDGWPVNLGSSVKILS--GGRMLRLMQTRPEDAGQ 2477

  Fly  2561 YMCRAYNAAGEAVSSTAMKVKTKSNIDGQPLIPESWEAIRLKEAAMNRVPEMFVDSTPQQAPVFT 2625
            |.|...|||||......:.|          |:|                |.:..::|.:..    
Mouse  2478 YTCIVRNAAGEDRKMFGLSV----------LVP----------------PHIVGENTLEDV---- 2512

  Fly  2626 THLQSYDKLHEGQHVLLEAQVEPRADPNLRIEWFKNGISL--------TTGSRIRSTFDFGLVTL 2682
                   |:.|.|.|.|..:|  |.:|..:|.|.|:|..|        .:|.|.          |
Mouse  2513 -------KIKEKQSVTLTCEV--RGNPVPQITWHKDGQLLQEDEAHHMMSGGRF----------L 2558

  Fly  2683 SINGLRADDSAIYTCKATNQVGEAVSTSSLKIEDRHWLQAESLHPDSLPRIGELEAPKEGRPEAP 2747
            .|...:...:..|||.|:|..|:...:..|.:             ...|.|..:::  :|.||  
Mouse  2559 QITNAQVSHTGRYTCLASNIAGDKSKSFRLNV-------------FVSPTIAGVDS--DGSPE-- 2606

  Fly  2748 EPTYETPVFITHLNNIECKESDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYCA 2812
                :..|.:....::.|            |....|..:|.||.:|.||::....:.:.  |...
Mouse  2607 ----DVIVILNSPTSLVC------------EAYSYPPATITWFKDGTPLESNRNIRILP--GGRT 2653

  Fly  2813 LDLTNSYAENSGVYTCKATNSKGSATTSGTLKCTGGKTMFLDTQHPQGEAGLEAVQETEEELANR 2877
            |.:.|:..:|:|.|:|.|||                            |||         |....
Mouse  2654 LQILNAQEDNAGRYSCVATN----------------------------EAG---------EKIKH 2681

  Fly  2878 YTSKTTKPETQYPPPVWTK---------PLQAEFHLSEAQPIHLEANVEPKEDPNLFIEWYFNGK 2933
            |..|.      |.||:..|         |.:.:..::.:..:..||...|...    :.||.:|:
Mouse  2682 YEVKV------YIPPIIKKGDLLGPGLSPKEVKIRVNSSLTLECEAYAIPSAS----LRWYKDGQ 2736

  Fly  2934 MLNHGSRFKMTSEFGFVTMDMIEVYARDQGIYTCKAYNKAGEAFTSTTIFCSSKENIIESTQHPK 2998
            .|.......:.:. |. |:.:.|....|.|.|||.|.|.||                        
Mouse  2737 PLKSDDHVTIAAS-GH-TLQIKEAQISDTGRYTCVASNLAG------------------------ 2775

  Fly  2999 GAEGLEQIQDLEDSLRKDGSKPEQPDLGIPPRFTT--EFVNIADIG-EGEL----------AHFE 3050
                       ||.|..|      .::.:||.|..  |..|:.|.| .||.          .|.|
Mouse  2776 -----------EDELDFD------VNIQVPPSFQKLWEIGNMLDTGRSGEAKDVIINNPLSLHCE 2823

  Fly  3051 ANLIPVGDQSMVIEWFYNGKVLEASHRVRTIYAFGTVALEVLGTKIEDTGTYTCRATNKHGTAEI 3115
            .|..|    ...:.|:.:|:.|.:|.|| .|...|.| |::...|:||.|.|||.|.|:.|...:
Mouse  2824 TNAAP----PPTLTWYKDGRPLTSSDRV-LILPGGRV-LQIPRAKVEDAGRYTCVAVNEAGEDSL 2882

  Fly  3116 SCNLECVDKP--RGQKPRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNR 3178
            ..::..:..|  :|........:..|.    .:|...||:  ...:|..:..|..:|:::.....
Mouse  2883 RYDVHVLLPPVIKGANSDLPEEVTVLV----NKSTQMECS--SSGNPAPRNYWQKDGQILLEDEH 2941

  Fly  3179 IKTVSDFGYVVLDISYLQDHDSGEYVCRAWN------KY------------GEDFTR-------- 3217
            .|..||..  .|.|...|..|:|.|||.|.|      ||            |.:...        
Mouse  2942 HKFQSDGR--SLQILNAQITDTGRYVCVAENTAGSAKKYFNLNVHVPPSVIGPNHEHLSVVVNHF 3004

  Fly  3218 TTLNC-----------------------------GGRGGVFYDSLQPDSLQRIR-------ELEC 3246
            .:|||                             |||           :||.||       :..|
Mouse  3005 ISLNCEVSGFPPPDLSWLKNEEPIKPNTNVLTVPGGR-----------TLQIIRAKISDGGDYTC 3058

  Fly  3247 PQGQQADTSAPLVA----EPPKFI---TQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGK 3304
            ....||..|...|:    .||...   :|.:.:..:.||.|...|.....:..|  |:.|..||:
Mouse  3059 IAINQAGESKKKVSLTVHVPPSIKDHGSQSLSIVNVREGTSVSLECESNAVPPP--VITWSKNGR 3121

  Fly  3305 KLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRASLKCASKSSLILDSQLPR 3369
            .:|........  .|...|.|......::|.|..||.|..|.|          ..:..|:..:|.
Mouse  3122 MIPDSTNVEIL--TGGQTLHIRRAEVSDTGQYVCRAINVAGRD----------DKNFHLNVYVPP 3174

  Fly  3370 GMEGGLEKIANLEYSMVRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADD---- 3430
            .:||                           |...|.:|.|.|           .:|...|    
Mouse  3175 TIEG---------------------------PETEVIVETISN-----------PVTLTCDATGI 3201

  Fly  3431 PKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTATMKIQG 3495
            |...:.|..|.:|::...........|...|:|:.....:||.|:|.|.|..|:|          
Mouse  3202 PPPTITWLKNHKPIENSDPLEVHILSGGSKLQIARPQRSNSGNYTCVASNMEGKA---------- 3256

  Fly  3496 KRSIIMESQLPKGMEGTIDRIAELEGLGSRSTEFVPDDDTGKPPEFITSPFDMVIGENALAHFEC 3560
            :::.|:..|:|..:.|     ||                       :.|...:::|||  ....|
Mouse  3257 QKNFILFIQVPPSVAG-----AE-----------------------VPSEVSVLLGEN--VELVC 3291

  Fly  3561 RLQPINDPSMRVDWFHNGKALWAG--SRIKTINDFGFVILEIAGCYQRDSGLYTCKATNKHGEAT 3623
            ....|  |:..:.|..:||.:..|  .|::...|..  .|.|......|.|.|||.|||..||..
Mouse  3292 NADGI--PTPHLQWLRDGKPIVNGETERVRVTTDGS--TLNIYRALTSDMGKYTCVATNPAGEED 3352

  Fly  3624 VSCKLQVKGRQGIVMEPQLPSNFRTGTESLQKLEETMHKREELVTEDEQPNPPKFTEEIKDNLDV 3688
            ....|.|      .:.|::..| :...|.|..|.:|                             
Mouse  3353 RIFNLNV------YVPPKIRGN-KEEAEKLMALVDT----------------------------- 3381

  Fly  3689 PEGGPIHFDCRVEPVGDPTMRIEWFYNGHVMATGSRVHQLNDFGFIALDVDYIYAR--DSGEYTC 3751
                .|:.:|:.  .|.|..:|.|..||..:...|.:..|:....:.:    :.|:  |...|||
Mouse  3382 ----SINIECKA--TGTPPPQINWLKNGLPLPISSHIRLLSAGQVVRI----VRAQVSDIAVYTC 3436

  Fly  3752 RATNKWGTATTSAKVTCKGKHNIVYESQLPEGMTSEKLKELERGRIPEAPKVVEEVFGPPKFTTQ 3816
            .|:|:.|.         ..||   |..|                           ||.||.....
Mouse  3437 VASNRAGV---------DSKH---YSLQ---------------------------VFVPPNMDNA 3462

  Fly  3817 I--TSVTVDEAEAVRFECQVEPKTDPSLRVEWYRNGKPL-PSGHRYRNIFDMGFVSLDILYVYGE 3878
            :  ..:|:.:..:....|..:....||:  .|.|:|:|| |..|  ..:...|.| |.::....|
Mouse  3463 MGTEEITIVKGSSTSMTCFTDGTPAPSM--SWLRDGQPLAPDAH--LTVSTQGMV-LQLIKAETE 3522

  Fly  3879 DSGEYVCRAINNYGEDRTRATVSCKKLPTILLQNQVPRGMKRSDALTQMEATIKKYTSEVHLTED 3943
            |:|:|.|.|.|..||                                     :.|:         
Mouse  3523 DTGKYTCVATNEAGE-------------------------------------VSKH--------- 3541

  Fly  3944 DLFDPDRKQPPRFVTQIKEQLTLT------EMAV---TKFECQLAPVGDPNMKVEWFFNGKPLLH 3999
                        ||.::.|...:.      |::|   ...|......|.|..|:.|..:|:|.|.
Mouse  3542 ------------FVLKVLEPPHINGSEGPGEVSVIVNNPLELSCIASGIPAPKISWMKDGRPFLQ 3594

  Fly  4000 KNRFQPIYDFGYVAMNFGWVYPEDSGEYVCRATNLYGKDETRAIIKVSGKPGIVYDSQLPAHMQS 4064
            ..:.|.:.  |...:.......||:|.|.|.|::..|.|:...:::|...|.|....:    .|.
Mouse  3595 TEQVQTLE--GGAILRVSSAQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGMDE----AQD 3653

  Fly  4065 IDRIREMEASWQVVPDEVDP------------DAKPRTKPVFVSK-LEPQTVEEGDPARF-CV-- 4113
            ...:|..:.:.:...|.|.|            .|.||.:.:...: |:....:.||.|.: ||  
Mouse  3654 FTVLRNRQVTLECKSDAVPPPVIMWLKNREQLQATPRVRILSGGRYLQINNADLGDTANYTCVAS 3718

  Fly  4114 ---------------------------------------RVTGHPRPRVMWLINGHTVVHG-SRY 4138
                                                   |..|.|.||:.|..:|..:... :||
Mouse  3719 NIAGKTTREFNLTVNVPPSIGGGPQSLVTLLNKSIALECRAEGVPAPRITWRKDGVVLAESHARY 3783

  Fly  4139 KLTNDGMFHLDVPKTRQYDTGKVEVIARNSVGESIATTELKV-----VARSDDYRNVLKNSPRPW 4198
            .:..:|..|::  .....|||:...:|.|..|......:|:|     :|.......|..|.    
Mouse  3784 SILENGFLHIE--SAHVTDTGRYLCMATNVAGTDRRRIDLQVHVPPSIAMGPTNVTVTVNV---- 3842

  Fly  4199 YDYELAAYQKERQENELEKVFDERKQVLSEQSSHTLKGVEHLKPKQYKPPTPDWQQNVKAKKSED 4263
                                    :..|:.:::    |:    ||    |:..|::|......:.
Mouse  3843 ------------------------QTTLACEAT----GI----PK----PSVTWRKNGHLLNVDQ 3871

  Fly  4264 YYNKLQTLETEQLLKETNLRRDTHQYAIPGEKVVSSSQAKGMAQSYEENLQEKTSTTEVQAAPPK 4328
            ..|..:.|.:..|:..:....||..|    |..|:|...           ::|.:.......||.
Mouse  3872 NQNSYRLLSSGSLVIISPSVDDTASY----ECTVTSDAG-----------EDKRAVDLTVQVPPT 3921

  Fly  4329 GIAQP---------------SESSVHGREVHMNKQQQVQKEIQGD---------LEITRKITATE 4369
            ...:|               |.|.|....:|..| ..::...:||         :||       .
Mouse  3922 IADEPMDFLVTRQAPAVMTCSASGVPVPSIHWTK-NGLRLLPRGDGYRILSSGAIEI-------P 3978

  Fly  4370 TTEVEHKGT---------------IQERVVQGPV---KPAKAPVFTKK--IQPCRVFENEQAKFE 4414
            ||::.|.|.               :..||.:.||   :|::..|....  :.||           
Mouse  3979 TTQLNHAGRYTCVARNAAGSAHRHVTLRVQEPPVIQPQPSELDVILNNPILLPC----------- 4032

  Fly  4415 VEFEGEPNPTVKWYRESFPIQNSPDLQIHTFSGKSILI-------IRQVFVEDSAVFSCVAENRG 4472
             |..|.|.|.:.|.:|...:         ..||||:.|       |.:....|:..:.|||:|..
Mouse  4033 -EATGIPTPFITWQKEGINV---------ITSGKSLAILPSGSLQISRAVRGDAGTYMCVAQNPA 4087

  Fly  4473 GTAKCSANLVVEERRRAGKGGIQPPSFVTTIQSTTVATGQLARFDAKVT------GTRPLDVYWL 4531
            |||.....|           .:|.|..:::.|...|.|     .|..|:      |:.|.|:.|.
Mouse  4088 GTALGKVKL-----------NVQVPPVISSHQKEYVVT-----MDKPVSLLCETEGSPPPDITWH 4136

  Fly  4532 KNGMKIQPSIKFKMLEEDSVHTLLIIEPFAEDSGRYECVAVNAAGEARCDGDCIVQSPSKPEKPT 4596
            |:|..:..||:.::|...::. :...:|  :|:|:|.|:|.|.||.:.......|..|       
Mouse  4137 KDGHALTESIRQRILNSGALQ-IAFAQP--DDAGQYTCMAANMAGSSSVSSTLTVHVP------- 4191

  Fly  4597 TPGSEKAPHIVEQLKSQTVEEGSKVIFRCRVDGKPTPTARW---------MRGENFVKPSRYFQM 4652
                   |.|.......||.|.|:.:..|..||.|||...|         :.|:...:|      
Mouse  4192 -------PRIQSTEVHFTVNENSQAVLPCVADGIPTPAIHWEKDGVLIANLLGKYTAQP------ 4243

  Fly  4653 SRQGEYYQLVISEAFPEDEGTYKCVAENKLGSIQTSAQLKVRPIENLDAPPTITALK-DVSVTEG 4716
                 |.:|::.....||.|||.|||.|..|.......|.|..:      ||.|.|. |:|:.:|
Mouse  4244 -----YGELILENVVLEDSGTYTCVANNAAGEDTRIVTLAVHTL------PTFTELPGDLSLNKG 4297

  Fly  4717 -------------------------MPAQFKT-------------------------TVTGKVK- 4730
                                     :||.|.:                         ...|.|| 
Mouse  4298 EQLRLSCKAVGIPLPKLTWTFNNNIIPAHFDSINGHSELVIEKVSKEDSGTYVCTAENSVGFVKA 4362

  Fly  4731 --------------------------------------ATSVQWFREGQLIPETPDFQMIFDGNS 4757
                                                  |.::||.|:|..|..:...:.:  ||.
Mouse  4363 IGFVYVKEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPAPTIQWSRKGADIEISHRIRQL--GNG 4425

  Fly  4758 AVLLIGTTYEEDSGIFTVRVTSSTGQVESSAKLTVKKRRISAFQLRTIDSAEDESSSSGR 4817
            ::.:.||. .||:|.:|....:..|.||.|..||::...|.     |::..|....:.||
Mouse  4426 SLAIYGTV-NEDAGDYTCVAANEAGMVERSMSLTLQSSPII-----TLEPVETVVDAGGR 4479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slsNP_001261304.1 I-set 87..174 CDD:400151 23/88 (26%)
Ig strand B 104..108 CDD:409353 1/3 (33%)
Ig strand C 117..121 CDD:409353 1/3 (33%)
Ig strand E 144..148 CDD:409353 2/3 (67%)
Ig strand F 158..163 CDD:409353 3/4 (75%)
I-set 255..344 CDD:400151 26/88 (30%)
Ig strand B 272..276 CDD:409353 0/3 (0%)
Ig strand C 285..289 CDD:409353 0/3 (0%)
Ig strand E 310..314 CDD:409353 2/3 (67%)
Ig strand F 324..329 CDD:409353 1/4 (25%)
Ig strand G 337..340 CDD:409353 0/2 (0%)
IgI_Myotilin_C_like 372..462 CDD:409405 26/91 (29%)
Ig strand A 372..375 CDD:409405 0/2 (0%)
Ig strand A' 378..383 CDD:409405 2/4 (50%)
Ig strand B 388..395 CDD:409405 1/6 (17%)
Ig strand C 402..408 CDD:409405 2/5 (40%)
Ig strand C' 409..412 CDD:409405 0/2 (0%)
Ig strand D 418..424 CDD:409405 3/7 (43%)
Ig strand E 427..437 CDD:409405 2/9 (22%)
Ig strand F 441..449 CDD:409405 3/7 (43%)
Ig strand G 451..462 CDD:409405 3/10 (30%)
I-set 471..560 CDD:400151 27/92 (29%)
Ig strand B 488..492 CDD:409353 1/3 (33%)
Ig strand C 501..505 CDD:409353 1/3 (33%)
Ig strand E 527..530 CDD:409353 1/2 (50%)
Ig strand F 540..545 CDD:409353 2/4 (50%)
Ig strand G 553..556 CDD:409353 0/2 (0%)
Ig 618..709 CDD:472250 27/95 (28%)
Ig strand B 635..639 CDD:409564 1/3 (33%)
Ig strand C 650..654 CDD:409564 0/3 (0%)
Ig strand E 675..679 CDD:409564 1/3 (33%)
Ig strand F 689..694 CDD:409564 3/4 (75%)
Ig strand G 702..705 CDD:409564 0/2 (0%)
Ig 751..835 CDD:472250 20/83 (24%)
Ig strand B 769..775 CDD:409353 0/5 (0%)
Ig strand C 784..788 CDD:409353 0/3 (0%)
Ig strand E 810..816 CDD:409353 2/5 (40%)
Ig strand F 823..828 CDD:409353 1/4 (25%)
Ig strand G 836..839 CDD:409353 0/2 (0%)
Ig 890..982 CDD:472250 24/92 (26%)
Ig strand B 908..912 CDD:409353 0/3 (0%)
Ig strand C 923..927 CDD:409353 0/3 (0%)
Ig strand E 948..952 CDD:409353 1/3 (33%)
Ig strand F 962..967 CDD:409353 3/4 (75%)
Ig strand G 975..978 CDD:409353 0/2 (0%)
Ig 1024..1116 CDD:472250 24/91 (26%)
Ig strand B 1042..1046 CDD:409353 0/3 (0%)
Ig strand C 1053..1061 CDD:409353 1/7 (14%)
Ig strand E 1082..1086 CDD:409353 1/3 (33%)
Ig strand F 1096..1101 CDD:409353 1/4 (25%)
Ig strand G 1109..1112 CDD:409353 0/2 (0%)
Ig 1158..1250 CDD:472250 23/91 (25%)
Ig strand B 1176..1180 CDD:409353 1/3 (33%)
Ig strand C 1191..1195 CDD:409353 0/3 (0%)
Ig strand E 1216..1220 CDD:409353 1/3 (33%)
Ig strand F 1230..1235 CDD:409353 1/4 (25%)
Ig strand G 1243..1246 CDD:409353 0/2 (0%)
Ig 1291..1380 CDD:472250 23/90 (26%)
Ig strand B 1308..1312 CDD:409564 2/3 (67%)
Ig strand C 1323..1327 CDD:409564 1/3 (33%)
Ig strand E 1348..1352 CDD:409564 1/3 (33%)
Ig strand F 1362..1367 CDD:409564 2/4 (50%)
Ig strand G 1375..1378 CDD:409564 0/2 (0%)
Ig 1424..1515 CDD:472250 21/90 (23%)
Ig strand B 1442..1446 CDD:409353 0/3 (0%)
Ig strand C 1457..1461 CDD:409353 0/3 (0%)
Ig strand E 1482..1486 CDD:409353 1/3 (33%)
Ig strand F 1496..1501 CDD:409353 3/4 (75%)
I-set 1558..1645 CDD:400151 22/90 (24%)
Ig strand B 1575..1579 CDD:409353 0/3 (0%)
Ig strand C 1590..1594 CDD:409353 0/3 (0%)
Ig strand E 1615..1619 CDD:409353 1/3 (33%)
Ig strand F 1629..1634 CDD:409353 2/4 (50%)
Ig strand G 1643..1646 CDD:409353 0/2 (0%)
I-set 1691..1782 CDD:400151 20/96 (21%)
Ig strand B 1708..1712 CDD:409353 0/3 (0%)
Ig strand C 1721..1727 CDD:409353 1/5 (20%)
Ig strand E 1748..1752 CDD:409353 2/8 (25%)
Ig strand F 1762..1767 CDD:409353 2/4 (50%)
Ig strand G 1775..1778 CDD:409353 0/2 (0%)
I-set 1824..1916 CDD:400151 25/114 (22%)
Ig strand B 1842..1846 CDD:409353 0/3 (0%)
Ig strand C 1857..1861 CDD:409353 0/3 (0%)
Ig strand E 1882..1886 CDD:409353 1/3 (33%)
Ig strand F 1896..1901 CDD:409353 3/4 (75%)
Ig strand G 1909..1912 CDD:409353 0/2 (0%)
Ig 1958..2049 CDD:472250 29/170 (17%)
Ig strand B 1975..1979 CDD:409564 1/3 (33%)
Ig strand C 1990..1994 CDD:409564 0/3 (0%)
Ig strand E 2015..2019 CDD:409564 2/3 (67%)
Ig strand F 2029..2034 CDD:409564 2/4 (50%)
Ig strand G 2042..2045 CDD:409564 1/12 (8%)
Ig 2089..2181 CDD:472250 23/91 (25%)
Ig strand B 2107..2111 CDD:409353 1/3 (33%)
Ig strand C 2122..2126 CDD:409353 0/3 (0%)
Ig strand E 2144..2151 CDD:409353 3/6 (50%)
Ig strand F 2161..2166 CDD:409353 2/4 (50%)
Ig strand G 2174..2177 CDD:409353 0/2 (0%)
Ig 2222..2314 CDD:472250 23/91 (25%)
Ig strand B 2240..2244 CDD:409353 0/3 (0%)
Ig strand C 2253..2259 CDD:409353 0/5 (0%)
Ig strand E 2280..2284 CDD:409353 1/3 (33%)
Ig strand F 2294..2299 CDD:409353 1/4 (25%)
Ig strand G 2307..2310 CDD:409353 0/2 (0%)
Ig 2356..2448 CDD:472250 21/96 (22%)
Ig strand C 2389..2393 CDD:409353 1/3 (33%)
Ig strand E 2414..2418 CDD:409353 1/3 (33%)
Ig strand F 2428..2433 CDD:409353 2/4 (50%)
Ig 2516..2577 CDD:409353 20/60 (33%)
Ig strand C 2521..2525 CDD:409353 0/3 (0%)
Ig strand E 2546..2550 CDD:409353 1/3 (33%)
Ig strand F 2560..2565 CDD:409353 2/4 (50%)
Ig strand G 2574..2577 CDD:409353 0/2 (0%)
I-set 2622..2714 CDD:400151 24/99 (24%)
Ig strand C 2655..2659 CDD:409353 1/3 (33%)
Ig strand E 2680..2684 CDD:409353 1/3 (33%)
Ig strand F 2694..2699 CDD:409353 3/4 (75%)
I-set 2754..2844 CDD:400151 20/89 (22%)
Ig strand B 2771..2775 CDD:409353 0/3 (0%)
Ig strand C 2786..2790 CDD:409353 1/3 (33%)
Ig strand E 2811..2815 CDD:409353 1/3 (33%)
Ig strand F 2825..2830 CDD:409353 2/4 (50%)
Ig strand G 2838..2841 CDD:409353 0/2 (0%)
Ig 2905..2981 CDD:472250 19/75 (25%)
Ig strand C 2925..2929 CDD:409353 0/3 (0%)
Ig strand E 2950..2954 CDD:409353 1/3 (33%)
Ig strand F 2964..2969 CDD:409353 3/4 (75%)
Ig strand G 2978..2981 CDD:409353 0/2 (0%)
Ig 3029..3120 CDD:472250 32/103 (31%)
Ig strand C 3062..3066 CDD:409353 0/3 (0%)
Ig strand E 3087..3091 CDD:409353 2/3 (67%)
Ig strand F 3101..3106 CDD:409353 3/4 (75%)
Ig 3130..3220 CDD:472250 23/115 (20%)
Ig strand B 3148..3152 CDD:409353 0/3 (0%)
Ig strand C 3163..3167 CDD:409353 0/3 (0%)
Ig strand E 3188..3192 CDD:409353 1/3 (33%)
Ig strand F 3202..3207 CDD:409353 3/4 (75%)
Ig strand G 3216..3219 CDD:409353 0/10 (0%)
Ig 3263..3354 CDD:472250 22/93 (24%)
Ig strand C 3296..3300 CDD:409353 1/3 (33%)
Ig strand E 3321..3325 CDD:409353 1/3 (33%)
Ig strand F 3335..3340 CDD:409353 1/4 (25%)
I-set 3401..3493 CDD:400151 22/95 (23%)
Ig strand C 3434..3438 CDD:409353 0/3 (0%)
Ig strand E 3459..3463 CDD:409353 1/3 (33%)
Ig strand F 3473..3478 CDD:409353 2/4 (50%)
Ig strand G 3487..3490 CDD:409353 0/2 (0%)
I-set 3539..3630 CDD:400151 26/92 (28%)
Ig strand B 3556..3560 CDD:409353 0/3 (0%)
Ig strand C 3571..3575 CDD:409353 0/3 (0%)
Ig strand E 3596..3600 CDD:409353 1/3 (33%)
Ig strand F 3610..3615 CDD:409353 3/4 (75%)
Ig strand G 3623..3626 CDD:409353 0/2 (0%)
Ig 3676..3767 CDD:472250 18/92 (20%)
Ig strand B 3694..3698 CDD:409353 1/3 (33%)
Ig strand C 3709..3713 CDD:409353 1/3 (33%)
Ig strand E 3734..3738 CDD:409353 0/3 (0%)
Ig strand F 3748..3753 CDD:409353 3/4 (75%)
Ig strand G 3761..3764 CDD:409353 0/2 (0%)
I-set 3811..3900 CDD:400151 24/91 (26%)
Ig strand B 3828..3832 CDD:409353 0/3 (0%)
Ig strand C 3841..3847 CDD:409353 1/5 (20%)
Ig strand E 3868..3872 CDD:409353 2/3 (67%)
Ig strand F 3882..3887 CDD:409353 2/4 (50%)
Ig strand G 3896..3899 CDD:409353 0/2 (0%)
Ig 3954..4046 CDD:472250 23/100 (23%)
Ig strand B 3972..3976 CDD:409353 0/3 (0%)
Ig strand C 3987..3991 CDD:409353 1/3 (33%)
Ig strand E 4009..4013 CDD:409353 1/3 (33%)
Ig strand F 4026..4031 CDD:409353 2/4 (50%)
Ig strand G 4039..4042 CDD:409353 0/2 (0%)
Ig 4092..4180 CDD:472250 24/131 (18%)
Ig strand B 4109..4113 CDD:409353 1/4 (25%)
Ig strand C 4122..4126 CDD:409353 1/3 (33%)
Ig strand E 4146..4150 CDD:409353 1/3 (33%)
Ig strand F 4160..4165 CDD:409353 0/4 (0%)
Ig strand G 4173..4176 CDD:409353 0/2 (0%)
Ig 4394..4484 CDD:472250 24/98 (24%)
Ig strand B 4411..4415 CDD:409353 0/3 (0%)
Ig strand C 4424..4428 CDD:409353 0/3 (0%)
Ig strand E 4449..4453 CDD:409353 2/10 (20%)
Ig strand F 4463..4468 CDD:409353 1/4 (25%)
Ig strand G 4476..4479 CDD:409353 0/2 (0%)
I-set 4497..4581 CDD:400151 24/89 (27%)
Ig strand B 4514..4518 CDD:409564 0/3 (0%)
Ig strand C 4527..4531 CDD:409564 1/3 (33%)
Ig strand E 4552..4556 CDD:409564 0/3 (0%)
Ig strand F 4566..4571 CDD:409564 2/4 (50%)
I-set 4604..4693 CDD:400151 28/97 (29%)
Ig strand B 4621..4625 CDD:409564 0/3 (0%)
Ig strand C 4634..4638 CDD:409564 1/12 (8%)
Ig strand E 4659..4663 CDD:409564 1/3 (33%)
Ig strand F 4673..4678 CDD:409564 3/4 (75%)
Ig strand G 4686..4689 CDD:409564 0/2 (0%)
Ig 4702..4792 CDD:472250 32/179 (18%)
Ig strand B 4719..4723 CDD:409564 2/3 (67%)
Ig strand C 4733..4737 CDD:409564 1/3 (33%)
Ig strand E 4758..4762 CDD:409564 0/3 (0%)
Ig strand F 4772..4777 CDD:409564 1/4 (25%)
Ig strand G 4785..4788 CDD:409564 1/2 (50%)
rne <5284..5662 CDD:236766
PTZ00121 <5931..6415 CDD:173412
I-set 6536..6622 CDD:400151
Ig strand B 6553..6557 CDD:409353
Ig strand C 6566..6570 CDD:409353
Ig strand E 6591..6595 CDD:409353
Ig strand F 6605..6610 CDD:409353
Ig strand G 6618..6621 CDD:409353
Ig 6633..6727 CDD:472250
Ig strand B 6650..6654 CDD:409353
Ig strand C 6667..6671 CDD:409353
Ig strand E 6694..6698 CDD:409353
Ig strand F 6708..6713 CDD:409353
Ig strand G 6721..6724 CDD:409353
Ig 6741..6829 CDD:472250
Ig strand B 6757..6761 CDD:409353
Ig strand C 6770..6774 CDD:409353
Ig strand F 6809..6814 CDD:409353
Ig strand G 6822..6825 CDD:409353
Ig 6841..6928 CDD:472250
Ig strand B 6858..6862 CDD:409564
Ig strand C 6871..6875 CDD:409564
Ig strand E 6896..6900 CDD:409564
Ig strand F 6910..6915 CDD:409564
Ig strand G 6923..6926 CDD:409564
I-set 6942..7033 CDD:400151
Ig strand B 6960..6964 CDD:409353
Ig strand C 6973..6977 CDD:409353
Ig strand E 6999..7003 CDD:409353
Ig strand F 7013..7018 CDD:409353
Ig strand G 7026..7029 CDD:409353
Ig 7066..7157 CDD:472250
Ig strand B 7084..7088 CDD:409353
Ig strand C 7097..7101 CDD:409353
Ig strand E 7123..7127 CDD:409353
Ig strand F 7137..7142 CDD:409353
Ig strand G 7150..7153 CDD:409353
Ig 7210..7289 CDD:472250
Ig strand B 7227..7231 CDD:409353
Ig strand C 7240..7244 CDD:409353
Ig strand E 7265..7269 CDD:409353
Ig strand F 7279..7284 CDD:409353
Ig strand G 7292..7295 CDD:409353
PTZ00121 <9687..10410 CDD:173412
PTZ00121 <10681..11475 CDD:173412
PTZ00121 <15007..15806 CDD:173412
rne <15728..15918 CDD:236766
SH3_p47phox_like 16753..16807 CDD:212790
I-set 16841..16931 CDD:400151
Ig strand B 16858..16862 CDD:409564
Ig strand C 16871..16875 CDD:409564
Ig strand E 16897..16901 CDD:409564
Ig strand F 16911..16916 CDD:409564
Ig strand G 16924..16927 CDD:409564
Ig_3 16964..17047 CDD:464046
I-set 17068..17152 CDD:400151
Ig strand B 17085..17089 CDD:409564
Ig strand C 17098..17102 CDD:409564
Ig strand E 17118..17122 CDD:409564
Ig strand F 17132..17137 CDD:409564
Ig strand G 17145..17148 CDD:409564
I-set 17176..17253 CDD:400151
Ig strand B 17180..17184 CDD:409564
Ig strand C 17193..17197 CDD:409564
Ig strand E 17218..17222 CDD:409564
Ig strand F 17233..17238 CDD:409564
Ig strand G 17246..17249 CDD:409564
Ig 17260..17342 CDD:472250
Ig strand B 17276..17280 CDD:409353
Ig strand C 17287..17291 CDD:409353
Ig strand E 17312..17316 CDD:409353
Ig strand F 17326..17331 CDD:409353
Ig 17347..17432 CDD:472250
Ig strand B 17364..17368 CDD:409353
Ig strand C 17376..17380 CDD:409353
Ig strand E 17402..17406 CDD:409353
Ig strand F 17416..17421 CDD:409353
Ig strand G 17425..17428 CDD:409353
Ig 17437..17521 CDD:472250
Ig strand B 17454..17458 CDD:409353
Ig strand C 17466..17470 CDD:409353
Ig strand E 17491..17495 CDD:409353
Ig strand F 17505..17510 CDD:409353
Ig strand G 17514..17517 CDD:409353
Ig 17538..17611 CDD:472250
Ig strand B 17544..17548 CDD:409353
Ig strand C 17556..17560 CDD:409353
Ig strand E 17581..17585 CDD:409353
Ig strand F 17595..17600 CDD:409353
Ig strand G 17604..17607 CDD:409353
Ig 17618..17708 CDD:472250
Ig strand B 17636..17640 CDD:409353
Ig strand C 17649..17653 CDD:409353
Ig strand E 17674..17678 CDD:409353
Ig strand F 17688..17693 CDD:409353
Ig strand G 17701..17704 CDD:409353
FN3 17712..17791 CDD:238020
Ig 17813..17898 CDD:472250
Ig strand B 17830..17834 CDD:409353
Ig strand C 17843..17847 CDD:409353
Ig strand E 17862..17869 CDD:409353
Ig strand F 17879..17884 CDD:409353
Ig 17917..17994 CDD:472250
Ig strand B 17922..17926 CDD:409353
Ig strand C 17935..17939 CDD:409353
Ig strand E 17960..17964 CDD:409353
Ig strand F 17974..17979 CDD:409353
Ig strand G 17987..17990 CDD:409353
FN3 17998..18090 CDD:238020
FN3 <18068..18364 CDD:442628
Hmcn1XP_006529820.1 ChlD <30..210 CDD:440853
Ig 520..608 CDD:472250 25/120 (21%)
Ig strand B 537..541 CDD:409544 1/3 (33%)
Ig strand C 550..554 CDD:409544 1/3 (33%)
Ig strand E 574..578 CDD:409544 2/3 (67%)
Ig strand F 588..593 CDD:409544 3/4 (75%)
Ig strand G 601..604 CDD:409544 0/2 (0%)
Ig_3 611..685 CDD:464046 23/121 (19%)
I-set 702..789 CDD:400151 31/109 (28%)
Ig strand B 719..723 CDD:409405 1/10 (10%)
Ig strand C 732..736 CDD:409405 1/3 (33%)
Ig strand E 755..759 CDD:409405 1/8 (13%)
Ig strand F 769..774 CDD:409405 1/4 (25%)
Ig strand G 782..785 CDD:409405 0/2 (0%)
Ig 793..884 CDD:472250 27/92 (29%)
Ig strand B 810..814 CDD:409353 1/3 (33%)
Ig strand C 823..829 CDD:409353 2/5 (40%)
Ig strand E 850..854 CDD:409353 3/5 (60%)
Ig strand F 864..869 CDD:409353 2/4 (50%)
Ig strand G 877..880 CDD:409353 0/2 (0%)
Ig 890..977 CDD:472250 15/96 (16%)
Ig strand B 907..911 CDD:409389 1/3 (33%)
Ig strand C 921..925 CDD:409389 0/3 (0%)
Ig strand E 943..947 CDD:409389 0/3 (0%)
Ig strand F 957..962 CDD:409389 0/4 (0%)
Ig 980..1071 CDD:472250 28/94 (30%)
Ig strand B 998..1002 CDD:409353 1/3 (33%)
Ig strand C 1011..1015 CDD:409353 0/5 (0%)
Ig strand E 1035..1038 CDD:409353 1/2 (50%)
Ig strand F 1048..1053 CDD:409353 3/4 (75%)
Ig strand G 1061..1064 CDD:409353 0/2 (0%)
I-set 1085..1167 CDD:400151 20/101 (20%)
Ig strand B 1097..1101 CDD:409544 1/3 (33%)
Ig strand C 1110..1114 CDD:409544 0/3 (0%)
Ig strand E 1133..1137 CDD:409544 2/5 (40%)
Ig strand F 1147..1152 CDD:409544 1/4 (25%)
Ig strand G 1160..1163 CDD:409544 0/2 (0%)
I-set 1171..1257 CDD:400151 27/135 (20%)
Ig strand B 1188..1192 CDD:409353 1/3 (33%)
Ig strand C 1201..1205 CDD:409353 0/3 (0%)
Ig strand E 1223..1227 CDD:409353 1/7 (14%)
Ig strand F 1237..1242 CDD:409353 3/4 (75%)
Ig strand G 1250..1253 CDD:409353 0/2 (0%)
Ig 1261..1354 CDD:472250 27/119 (23%)
Ig strand B 1283..1287 CDD:409353 1/3 (33%)
Ig strand C 1296..1300 CDD:409353 1/3 (33%)
Ig strand E 1319..1323 CDD:409353 1/4 (25%)
Ig strand F 1334..1339 CDD:409353 1/4 (25%)
Ig strand G 1347..1350 CDD:409353 0/2 (0%)
I-set 1368..1447 CDD:400151 24/97 (25%)
Ig strand B 1377..1381 CDD:409353 1/14 (7%)
Ig strand C 1390..1394 CDD:409353 0/3 (0%)
Ig strand E 1413..1417 CDD:409353 1/4 (25%)
Ig strand F 1427..1432 CDD:409353 1/4 (25%)
IG_like 1459..1541 CDD:214653 23/121 (19%)
Ig strand B 1470..1474 CDD:409544 2/3 (67%)
Ig strand C 1483..1487 CDD:409544 1/3 (33%)
Ig strand E 1506..1511 CDD:409544 1/4 (25%)
Ig strand F 1521..1526 CDD:409544 2/4 (50%)
Ig strand G 1534..1537 CDD:409544 0/2 (0%)
Ig 1564..1632 CDD:472250 22/93 (24%)
Ig strand B 1564..1568 CDD:409353 1/25 (4%)
Ig strand C 1577..1581 CDD:409353 0/3 (0%)
Ig strand E 1600..1604 CDD:409353 1/4 (25%)
Ig strand F 1614..1619 CDD:409353 3/4 (75%)
I-set 1644..1728 CDD:400151 25/136 (18%)
Ig strand B 1658..1662 CDD:409389 0/3 (0%)
Ig strand C 1671..1675 CDD:409389 0/3 (0%)
Ig strand E 1693..1698 CDD:409389 1/4 (25%)
Ig strand F 1708..1713 CDD:409389 2/4 (50%)
I-set 1751..1821 CDD:400151 23/117 (20%)
Ig strand B 1752..1755 CDD:409353 0/2 (0%)
Ig strand C 1764..1768 CDD:409353 1/3 (33%)
Ig strand E 1786..1791 CDD:409353 0/4 (0%)
Ig strand F 1801..1806 CDD:409353 2/4 (50%)
Ig strand G 1814..1817 CDD:409353 1/2 (50%)
IG_like 1833..1938 CDD:214653 24/106 (23%)
Ig strand B 1843..1847 CDD:409353 0/3 (0%)
Ig strand C 1856..1860 CDD:409353 0/5 (0%)
Ig strand E 1886..1908 CDD:409353 3/21 (14%)
Ig strand F 1918..1923 CDD:409353 3/4 (75%)
Ig strand G 1931..1934 CDD:409353 0/2 (0%)
Ig 1952..2023 CDD:472250 22/74 (30%)
Ig strand B 1961..1965 CDD:409544 1/3 (33%)
Ig strand C 1974..1978 CDD:409544 0/3 (0%)
Ig strand E 1997..2001 CDD:409544 2/4 (50%)
Ig strand F 2011..2016 CDD:409544 2/4 (50%)
Ig 2044..2115 CDD:472250 7/70 (10%)
Ig strand B 2052..2056 CDD:409389 0/3 (0%)
Ig strand C 2065..2069 CDD:409389 0/3 (0%)
Ig strand E 2088..2093 CDD:409389 0/4 (0%)
Ig strand F 2103..2108 CDD:409389 2/4 (50%)
I-set 2134..2214 CDD:400151 23/94 (24%)
Ig strand B 2144..2148 CDD:409353 1/3 (33%)
Ig strand C 2157..2161 CDD:409353 1/5 (20%)
Ig strand E 2179..2184 CDD:409353 3/5 (60%)
Ig strand F 2194..2199 CDD:409353 2/4 (50%)
Ig strand G 2207..2210 CDD:409353 0/2 (0%)
I-set 2226..2309 CDD:400151 28/116 (24%)
Ig strand B 2237..2241 CDD:409405 0/3 (0%)
Ig strand C 2250..2254 CDD:409405 1/3 (33%)
Ig strand E 2276..2279 CDD:409405 1/2 (50%)
Ig strand F 2289..2294 CDD:409405 1/4 (25%)
Ig strand G 2304..2307 CDD:409405 0/2 (0%)
Ig_3 2312..2390 CDD:464046 22/122 (18%)
Ig strand B 2427..2431 CDD:409353 1/35 (3%)
Ig <2429..2497 CDD:472250 24/105 (23%)
Ig strand C 2440..2444 CDD:409353 1/5 (20%)
Ig strand E 2461..2467 CDD:409353 2/5 (40%)
Ig strand F 2477..2482 CDD:409353 2/4 (50%)
I-set 2501..2590 CDD:400151 26/111 (23%)
Ig strand B 2520..2524 CDD:409562 2/3 (67%)
Ig strand C 2533..2537 CDD:409562 1/3 (33%)
Ig strand E 2556..2560 CDD:409562 2/13 (15%)
Ig strand F 2570..2575 CDD:409562 3/4 (75%)
Ig strand G 2583..2586 CDD:409562 0/2 (0%)
I-set 2605..2686 CDD:400151 27/137 (20%)
Ig strand B 2617..2620 CDD:409353 0/2 (0%)
Ig strand C 2629..2633 CDD:409353 1/3 (33%)
Ig strand E 2652..2656 CDD:409353 1/3 (33%)
Ig strand F 2666..2671 CDD:409353 2/4 (50%)
I-set 2704..2785 CDD:400151 24/127 (19%)
Ig strand B 2715..2719 CDD:409544 0/3 (0%)
Ig strand C 2728..2732 CDD:409544 0/7 (0%)
Ig strand E 2750..2755 CDD:409544 2/5 (40%)
Ig strand F 2765..2770 CDD:409544 3/4 (75%)
I-set 2812..2881 CDD:400151 24/74 (32%)
Ig strand B 2818..2822 CDD:409353 0/3 (0%)
Ig strand C 2831..2835 CDD:409353 0/3 (0%)
Ig strand E 2854..2858 CDD:409353 2/4 (50%)
Ig strand F 2868..2873 CDD:409353 3/4 (75%)
I-set 2902..2983 CDD:400151 22/88 (25%)
Ig strand B 2913..2917 CDD:409544 0/3 (0%)
Ig strand C 2926..2930 CDD:409544 0/3 (0%)
Ig strand E 2948..2953 CDD:409544 1/6 (17%)
Ig strand F 2963..2968 CDD:409544 3/4 (75%)
I-set 3005..3075 CDD:400151 15/80 (19%)
Ig strand B 3005..3009 CDD:409353 1/3 (33%)
Ig strand C 3018..3022 CDD:409353 0/3 (0%)
Ig strand E 3041..3045 CDD:409353 2/14 (14%)
Ig strand F 3055..3060 CDD:409353 1/4 (25%)
Ig strand G 3068..3071 CDD:409353 0/2 (0%)
I-set 3087..3170 CDD:400151 22/96 (23%)
Ig strand B 3100..3104 CDD:409562 0/3 (0%)
Ig strand C 3113..3117 CDD:409562 1/3 (33%)
Ig strand E 3136..3140 CDD:409562 1/3 (33%)
Ig strand F 3150..3155 CDD:409562 1/4 (25%)
Ig strand G 3163..3166 CDD:409562 0/2 (0%)
Ig_3 3173..3251 CDD:464046 22/115 (19%)
Ig 3267..3361 CDD:472250 31/133 (23%)
Ig strand B 3287..3291 CDD:409353 0/3 (0%)
Ig strand C 3300..3304 CDD:409353 0/3 (0%)
Ig strand E 3325..3329 CDD:409353 1/5 (20%)
Ig strand F 3339..3344 CDD:409353 3/4 (75%)
Ig strand G 3352..3355 CDD:409353 0/2 (0%)
I-set 3377..3453 CDD:400151 24/153 (16%)
Ig strand B 3383..3387 CDD:409562 1/3 (33%)
Ig strand C 3396..3400 CDD:409562 1/3 (33%)
Ig strand E 3419..3423 CDD:409562 0/3 (0%)
Ig strand F 3433..3438 CDD:409562 3/4 (75%)
Ig strand G 3446..3449 CDD:409562 2/5 (40%)
I-set 3468..3546 CDD:400151 26/140 (19%)
Ig strand B 3476..3480 CDD:409544 0/3 (0%)
Ig strand C 3489..3493 CDD:409544 1/5 (20%)
Ig strand E 3511..3516 CDD:409544 3/5 (60%)
Ig strand F 3526..3531 CDD:409544 2/4 (50%)
Ig strand G 3539..3542 CDD:409544 1/23 (4%)
Ig 3556..3629 CDD:472250 18/74 (24%)
Ig strand B 3569..3573 CDD:409544 1/3 (33%)
Ig strand C 3582..3586 CDD:409544 1/3 (33%)
Ig strand E 3604..3609 CDD:409544 0/4 (0%)
Ig strand F 3619..3624 CDD:409544 2/4 (50%)
I-set 3652..3732 CDD:400151 14/79 (18%)
Ig strand B 3662..3666 CDD:409353 0/3 (0%)
Ig strand C 3675..3679 CDD:409353 0/3 (0%)
Ig strand E 3698..3702 CDD:409353 1/3 (33%)
Ig strand F 3712..3717 CDD:409353 1/4 (25%)
I-set 3736..3823 CDD:400151 18/88 (20%)
Ig strand B 3753..3757 CDD:409544 0/3 (0%)
Ig strand C 3766..3770 CDD:409544 1/3 (33%)
Ig strand E 3789..3793 CDD:409544 1/3 (33%)
Ig strand F 3803..3808 CDD:409544 0/4 (0%)
Ig 3846..3907 CDD:409353 16/87 (18%)
Ig strand C 3857..3861 CDD:409353 0/3 (0%)
Ig strand E 3882..3886 CDD:409353 1/3 (33%)
Ig strand F 3896..3901 CDD:409353 2/8 (25%)
Ig 3922..4007 CDD:472250 14/92 (15%)
Ig strand B 3937..3941 CDD:409544 0/3 (0%)
Ig strand C 3950..3954 CDD:409544 1/3 (33%)
Ig strand E 3973..3977 CDD:409544 0/3 (0%)
Ig strand F 3987..3992 CDD:409544 0/4 (0%)
Ig strand G 4000..4003 CDD:409544 0/2 (0%)
Ig_3 4010..4085 CDD:464046 22/95 (23%)
Ig_3 4101..4175 CDD:464046 21/81 (26%)
Ig_3 4191..4266 CDD:464046 26/99 (26%)
I-set 4283..4368 CDD:400151 13/84 (15%)
Ig strand B 4300..4304 CDD:409405 0/3 (0%)
Ig strand C 4313..4317 CDD:409405 0/3 (0%)
Ig strand E 4334..4338 CDD:409405 0/3 (0%)
Ig strand F 4348..4353 CDD:409405 0/4 (0%)
Ig 4379..4458 CDD:472250 18/81 (22%)
Ig strand B 4390..4394 CDD:409390 0/3 (0%)
Ig strand C 4403..4407 CDD:409390 1/3 (33%)
Ig strand E 4425..4429 CDD:409390 0/3 (0%)
Ig strand F 4439..4444 CDD:409390 1/4 (25%)
Ig strand G 4452..4455 CDD:409390 1/2 (50%)
Ig 4464..4549 CDD:472250 5/21 (24%)
Ig strand B 4480..4484 CDD:409544 1069/5260 (20%)
Ig strand C 4493..4497 CDD:409544
Ig strand E 4515..4519 CDD:409544
Ig strand F 4529..4534 CDD:409544
Ig strand G 4542..4545 CDD:409544
TSP1 4556..4607 CDD:214559
TSP1 4612..4664 CDD:214559
TSP1 4669..4721 CDD:214559
TSP1 4726..4778 CDD:214559
TSP1 4783..4835 CDD:214559
TSP1 4840..4892 CDD:214559
G2F 4891..5115 CDD:214774
EGF_CA 5130..5169 CDD:214542
EGF_CA 5170..5197 CDD:429571
EGF_CA 5215..5252 CDD:214542
EGF_CA 5253..5286 CDD:238011
EGF_CA 5295..5326 CDD:429571
EGF_CA 5338..5377 CDD:214542
EGF_CA 5455..5494 CDD:214542
EGF_CA 5495..5531 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.