DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sls and Fgfrl1

DIOPT Version :10

Sequence 1:NP_001261304.1 Gene:sls / 44013 FlyBaseID:FBgn0086906 Length:18468 Species:Drosophila melanogaster
Sequence 2:NP_954545.1 Gene:Fgfrl1 / 360903 RGDID:735156 Length:529 Species:Rattus norvegicus


Alignment Length:345 Identity:89/345 - (25%)
Similarity:137/345 - (39%) Gaps:54/345 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  4489 AGKGGIQPPSFVTTIQSTTVA-TGQLARFDAKVTGTRPLDVYWLKNGMKIQPS-IKFKMLEEDSV 4551
            |.:|   ||.....:....|| .|:..|....|.|..|....|.|:|..|... .:|::|.:.  
  Rat    20 AARG---PPRMADKVVPRQVARLGRTVRLQCPVEGDPPPLTMWTKDGRTIHSGWSRFRVLPQG-- 79

  Fly  4552 HTLLIIEPFAEDSGRYECVAVNAAGEARCDGDCIVQ---SPSKPEKPTTPGSE-----------K 4602
              |.:.|..|||:|.|.|.|.|..|....:...|:.   ||.| |.|...||.           .
  Rat    80 --LKVKEVEAEDAGVYVCKATNGFGSLSVNYTLIIMDDISPGK-ENPGPGGSSGGQEDPVSQQWA 141

  Fly  4603 APHIVE--QLKSQTVEE--GSKVIFRCRVDGKPTPTARWMRGENFVKPSRYFQMSRQGEYYQLVI 4663
            .|...:  :::.:.:..  ||.|..:|...|.|.|...||:.:..:  :|......:.:.:.|.:
  Rat   142 RPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDIMWMKDDQTL--TRLEASEHRKKKWTLSL 204

  Fly  4664 SEAFPEDEGTYKCVAENKLGSIQTSAQLKVRPIENLDAPPTITALKDVSVTE--GMPAQFKTTVT 4726
            ....|||.|.|.|...|:.|:|  :|..||..|:...:.|.:|....|:.|.  |....|:..|.
  Rat   205 KNLKPEDSGKYTCRVSNRAGAI--NATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVR 267

  Fly  4727 GKVKATSVQWFR------EGQ------------LIPETPDFQMIFDGNSA-VLLIGTTYEEDSGI 4772
            ..||.. :||.:      ||:            ::..|.|.....||:.. .|||....::|:|:
  Rat   268 SDVKPV-IQWLKRVEYGSEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLLISRARQDDAGM 331

  Fly  4773 FTVRVTSSTGQVESSAKLTV 4792
            :.....::.|....||.|||
  Rat   332 YICLGANTMGYSFRSAFLTV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slsNP_001261304.1 I-set 87..174 CDD:400151
Ig strand B 104..108 CDD:409353
Ig strand C 117..121 CDD:409353
Ig strand E 144..148 CDD:409353
Ig strand F 158..163 CDD:409353
I-set 255..344 CDD:400151
Ig strand B 272..276 CDD:409353
Ig strand C 285..289 CDD:409353
Ig strand E 310..314 CDD:409353
Ig strand F 324..329 CDD:409353
Ig strand G 337..340 CDD:409353
IgI_Myotilin_C_like 372..462 CDD:409405
Ig strand A 372..375 CDD:409405
Ig strand A' 378..383 CDD:409405
Ig strand B 388..395 CDD:409405
Ig strand C 402..408 CDD:409405
Ig strand C' 409..412 CDD:409405
Ig strand D 418..424 CDD:409405
Ig strand E 427..437 CDD:409405
Ig strand F 441..449 CDD:409405
Ig strand G 451..462 CDD:409405
I-set 471..560 CDD:400151
Ig strand B 488..492 CDD:409353
Ig strand C 501..505 CDD:409353
Ig strand E 527..530 CDD:409353
Ig strand F 540..545 CDD:409353
Ig strand G 553..556 CDD:409353
Ig 618..709 CDD:472250
Ig strand B 635..639 CDD:409564
Ig strand C 650..654 CDD:409564
Ig strand E 675..679 CDD:409564
Ig strand F 689..694 CDD:409564
Ig strand G 702..705 CDD:409564
Ig 751..835 CDD:472250
Ig strand B 769..775 CDD:409353
Ig strand C 784..788 CDD:409353
Ig strand E 810..816 CDD:409353
Ig strand F 823..828 CDD:409353
Ig strand G 836..839 CDD:409353
Ig 890..982 CDD:472250
Ig strand B 908..912 CDD:409353
Ig strand C 923..927 CDD:409353
Ig strand E 948..952 CDD:409353
Ig strand F 962..967 CDD:409353
Ig strand G 975..978 CDD:409353
Ig 1024..1116 CDD:472250
Ig strand B 1042..1046 CDD:409353
Ig strand C 1053..1061 CDD:409353
Ig strand E 1082..1086 CDD:409353
Ig strand F 1096..1101 CDD:409353
Ig strand G 1109..1112 CDD:409353
Ig 1158..1250 CDD:472250
Ig strand B 1176..1180 CDD:409353
Ig strand C 1191..1195 CDD:409353
Ig strand E 1216..1220 CDD:409353
Ig strand F 1230..1235 CDD:409353
Ig strand G 1243..1246 CDD:409353
Ig 1291..1380 CDD:472250
Ig strand B 1308..1312 CDD:409564
Ig strand C 1323..1327 CDD:409564
Ig strand E 1348..1352 CDD:409564
Ig strand F 1362..1367 CDD:409564
Ig strand G 1375..1378 CDD:409564
Ig 1424..1515 CDD:472250
Ig strand B 1442..1446 CDD:409353
Ig strand C 1457..1461 CDD:409353
Ig strand E 1482..1486 CDD:409353
Ig strand F 1496..1501 CDD:409353
I-set 1558..1645 CDD:400151
Ig strand B 1575..1579 CDD:409353
Ig strand C 1590..1594 CDD:409353
Ig strand E 1615..1619 CDD:409353
Ig strand F 1629..1634 CDD:409353
Ig strand G 1643..1646 CDD:409353
I-set 1691..1782 CDD:400151
Ig strand B 1708..1712 CDD:409353
Ig strand C 1721..1727 CDD:409353
Ig strand E 1748..1752 CDD:409353
Ig strand F 1762..1767 CDD:409353
Ig strand G 1775..1778 CDD:409353
I-set 1824..1916 CDD:400151
Ig strand B 1842..1846 CDD:409353
Ig strand C 1857..1861 CDD:409353
Ig strand E 1882..1886 CDD:409353
Ig strand F 1896..1901 CDD:409353
Ig strand G 1909..1912 CDD:409353
Ig 1958..2049 CDD:472250
Ig strand B 1975..1979 CDD:409564
Ig strand C 1990..1994 CDD:409564
Ig strand E 2015..2019 CDD:409564
Ig strand F 2029..2034 CDD:409564
Ig strand G 2042..2045 CDD:409564
Ig 2089..2181 CDD:472250
Ig strand B 2107..2111 CDD:409353
Ig strand C 2122..2126 CDD:409353
Ig strand E 2144..2151 CDD:409353
Ig strand F 2161..2166 CDD:409353
Ig strand G 2174..2177 CDD:409353
Ig 2222..2314 CDD:472250
Ig strand B 2240..2244 CDD:409353
Ig strand C 2253..2259 CDD:409353
Ig strand E 2280..2284 CDD:409353
Ig strand F 2294..2299 CDD:409353
Ig strand G 2307..2310 CDD:409353
Ig 2356..2448 CDD:472250
Ig strand C 2389..2393 CDD:409353
Ig strand E 2414..2418 CDD:409353
Ig strand F 2428..2433 CDD:409353
Ig 2516..2577 CDD:409353
Ig strand C 2521..2525 CDD:409353
Ig strand E 2546..2550 CDD:409353
Ig strand F 2560..2565 CDD:409353
Ig strand G 2574..2577 CDD:409353
I-set 2622..2714 CDD:400151
Ig strand C 2655..2659 CDD:409353
Ig strand E 2680..2684 CDD:409353
Ig strand F 2694..2699 CDD:409353
I-set 2754..2844 CDD:400151
Ig strand B 2771..2775 CDD:409353
Ig strand C 2786..2790 CDD:409353
Ig strand E 2811..2815 CDD:409353
Ig strand F 2825..2830 CDD:409353
Ig strand G 2838..2841 CDD:409353
Ig 2905..2981 CDD:472250
Ig strand C 2925..2929 CDD:409353
Ig strand E 2950..2954 CDD:409353
Ig strand F 2964..2969 CDD:409353
Ig strand G 2978..2981 CDD:409353
Ig 3029..3120 CDD:472250
Ig strand C 3062..3066 CDD:409353
Ig strand E 3087..3091 CDD:409353
Ig strand F 3101..3106 CDD:409353
Ig 3130..3220 CDD:472250
Ig strand B 3148..3152 CDD:409353
Ig strand C 3163..3167 CDD:409353
Ig strand E 3188..3192 CDD:409353
Ig strand F 3202..3207 CDD:409353
Ig strand G 3216..3219 CDD:409353
Ig 3263..3354 CDD:472250
Ig strand C 3296..3300 CDD:409353
Ig strand E 3321..3325 CDD:409353
Ig strand F 3335..3340 CDD:409353
I-set 3401..3493 CDD:400151
Ig strand C 3434..3438 CDD:409353
Ig strand E 3459..3463 CDD:409353
Ig strand F 3473..3478 CDD:409353
Ig strand G 3487..3490 CDD:409353
I-set 3539..3630 CDD:400151
Ig strand B 3556..3560 CDD:409353
Ig strand C 3571..3575 CDD:409353
Ig strand E 3596..3600 CDD:409353
Ig strand F 3610..3615 CDD:409353
Ig strand G 3623..3626 CDD:409353
Ig 3676..3767 CDD:472250
Ig strand B 3694..3698 CDD:409353
Ig strand C 3709..3713 CDD:409353
Ig strand E 3734..3738 CDD:409353
Ig strand F 3748..3753 CDD:409353
Ig strand G 3761..3764 CDD:409353
I-set 3811..3900 CDD:400151
Ig strand B 3828..3832 CDD:409353
Ig strand C 3841..3847 CDD:409353
Ig strand E 3868..3872 CDD:409353
Ig strand F 3882..3887 CDD:409353
Ig strand G 3896..3899 CDD:409353
Ig 3954..4046 CDD:472250
Ig strand B 3972..3976 CDD:409353
Ig strand C 3987..3991 CDD:409353
Ig strand E 4009..4013 CDD:409353
Ig strand F 4026..4031 CDD:409353
Ig strand G 4039..4042 CDD:409353
Ig 4092..4180 CDD:472250
Ig strand B 4109..4113 CDD:409353
Ig strand C 4122..4126 CDD:409353
Ig strand E 4146..4150 CDD:409353
Ig strand F 4160..4165 CDD:409353
Ig strand G 4173..4176 CDD:409353
Ig 4394..4484 CDD:472250
Ig strand B 4411..4415 CDD:409353
Ig strand C 4424..4428 CDD:409353
Ig strand E 4449..4453 CDD:409353
Ig strand F 4463..4468 CDD:409353
Ig strand G 4476..4479 CDD:409353
I-set 4497..4581 CDD:400151 25/85 (29%)
Ig strand B 4514..4518 CDD:409564 1/3 (33%)
Ig strand C 4527..4531 CDD:409564 0/3 (0%)
Ig strand E 4552..4556 CDD:409564 1/3 (33%)
Ig strand F 4566..4571 CDD:409564 2/4 (50%)
I-set 4604..4693 CDD:400151 22/92 (24%)
Ig strand B 4621..4625 CDD:409564 1/3 (33%)
Ig strand C 4634..4638 CDD:409564 0/3 (0%)
Ig strand E 4659..4663 CDD:409564 1/3 (33%)
Ig strand F 4673..4678 CDD:409564 2/4 (50%)
Ig strand G 4686..4689 CDD:409564 0/2 (0%)
Ig 4702..4792 CDD:472250 26/110 (24%)
Ig strand B 4719..4723 CDD:409564 1/3 (33%)
Ig strand C 4733..4737 CDD:409564 1/3 (33%)
Ig strand E 4758..4762 CDD:409564 1/4 (25%)
Ig strand F 4772..4777 CDD:409564 0/4 (0%)
Ig strand G 4785..4788 CDD:409564 0/2 (0%)
rne <5284..5662 CDD:236766
PTZ00121 <5931..6415 CDD:173412
I-set 6536..6622 CDD:400151
Ig strand B 6553..6557 CDD:409353
Ig strand C 6566..6570 CDD:409353
Ig strand E 6591..6595 CDD:409353
Ig strand F 6605..6610 CDD:409353
Ig strand G 6618..6621 CDD:409353
Ig 6633..6727 CDD:472250
Ig strand B 6650..6654 CDD:409353
Ig strand C 6667..6671 CDD:409353
Ig strand E 6694..6698 CDD:409353
Ig strand F 6708..6713 CDD:409353
Ig strand G 6721..6724 CDD:409353
Ig 6741..6829 CDD:472250
Ig strand B 6757..6761 CDD:409353
Ig strand C 6770..6774 CDD:409353
Ig strand F 6809..6814 CDD:409353
Ig strand G 6822..6825 CDD:409353
Ig 6841..6928 CDD:472250
Ig strand B 6858..6862 CDD:409564
Ig strand C 6871..6875 CDD:409564
Ig strand E 6896..6900 CDD:409564
Ig strand F 6910..6915 CDD:409564
Ig strand G 6923..6926 CDD:409564
I-set 6942..7033 CDD:400151
Ig strand B 6960..6964 CDD:409353
Ig strand C 6973..6977 CDD:409353
Ig strand E 6999..7003 CDD:409353
Ig strand F 7013..7018 CDD:409353
Ig strand G 7026..7029 CDD:409353
Ig 7066..7157 CDD:472250
Ig strand B 7084..7088 CDD:409353
Ig strand C 7097..7101 CDD:409353
Ig strand E 7123..7127 CDD:409353
Ig strand F 7137..7142 CDD:409353
Ig strand G 7150..7153 CDD:409353
Ig 7210..7289 CDD:472250
Ig strand B 7227..7231 CDD:409353
Ig strand C 7240..7244 CDD:409353
Ig strand E 7265..7269 CDD:409353
Ig strand F 7279..7284 CDD:409353
Ig strand G 7292..7295 CDD:409353
PTZ00121 <9687..10410 CDD:173412
PTZ00121 <10681..11475 CDD:173412
PTZ00121 <15007..15806 CDD:173412
rne <15728..15918 CDD:236766
SH3_p47phox_like 16753..16807 CDD:212790
I-set 16841..16931 CDD:400151
Ig strand B 16858..16862 CDD:409564
Ig strand C 16871..16875 CDD:409564
Ig strand E 16897..16901 CDD:409564
Ig strand F 16911..16916 CDD:409564
Ig strand G 16924..16927 CDD:409564
Ig_3 16964..17047 CDD:464046
I-set 17068..17152 CDD:400151
Ig strand B 17085..17089 CDD:409564
Ig strand C 17098..17102 CDD:409564
Ig strand E 17118..17122 CDD:409564
Ig strand F 17132..17137 CDD:409564
Ig strand G 17145..17148 CDD:409564
I-set 17176..17253 CDD:400151
Ig strand B 17180..17184 CDD:409564
Ig strand C 17193..17197 CDD:409564
Ig strand E 17218..17222 CDD:409564
Ig strand F 17233..17238 CDD:409564
Ig strand G 17246..17249 CDD:409564
Ig 17260..17342 CDD:472250
Ig strand B 17276..17280 CDD:409353
Ig strand C 17287..17291 CDD:409353
Ig strand E 17312..17316 CDD:409353
Ig strand F 17326..17331 CDD:409353
Ig 17347..17432 CDD:472250
Ig strand B 17364..17368 CDD:409353
Ig strand C 17376..17380 CDD:409353
Ig strand E 17402..17406 CDD:409353
Ig strand F 17416..17421 CDD:409353
Ig strand G 17425..17428 CDD:409353
Ig 17437..17521 CDD:472250
Ig strand B 17454..17458 CDD:409353
Ig strand C 17466..17470 CDD:409353
Ig strand E 17491..17495 CDD:409353
Ig strand F 17505..17510 CDD:409353
Ig strand G 17514..17517 CDD:409353
Ig 17538..17611 CDD:472250
Ig strand B 17544..17548 CDD:409353
Ig strand C 17556..17560 CDD:409353
Ig strand E 17581..17585 CDD:409353
Ig strand F 17595..17600 CDD:409353
Ig strand G 17604..17607 CDD:409353
Ig 17618..17708 CDD:472250
Ig strand B 17636..17640 CDD:409353
Ig strand C 17649..17653 CDD:409353
Ig strand E 17674..17678 CDD:409353
Ig strand F 17688..17693 CDD:409353
Ig strand G 17701..17704 CDD:409353
FN3 17712..17791 CDD:238020
Ig 17813..17898 CDD:472250
Ig strand B 17830..17834 CDD:409353
Ig strand C 17843..17847 CDD:409353
Ig strand E 17862..17869 CDD:409353
Ig strand F 17879..17884 CDD:409353
Ig 17917..17994 CDD:472250
Ig strand B 17922..17926 CDD:409353
Ig strand C 17935..17939 CDD:409353
Ig strand E 17960..17964 CDD:409353
Ig strand F 17974..17979 CDD:409353
Ig strand G 17987..17990 CDD:409353
FN3 17998..18090 CDD:238020
FN3 <18068..18364 CDD:442628
Fgfrl1NP_954545.1 I-set 29..112 CDD:400151 24/86 (28%)
Ig strand B 43..47 CDD:409390 1/3 (33%)
Ig strand C 56..60 CDD:409390 0/3 (0%)
Ig strand E 78..82 CDD:409390 1/7 (14%)
Ig strand F 92..97 CDD:409390 2/4 (50%)
Ig strand G 105..108 CDD:409390 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..152 8/35 (23%)
IgI_2_FGFRL1-like 143..234 CDD:409442 24/94 (26%)
Ig strand A 143..146 CDD:409442 1/2 (50%)
Ig strand A' 154..159 CDD:409442 0/4 (0%)
Ig strand B 163..171 CDD:409442 2/7 (29%)
Ig strand C 177..182 CDD:409442 1/4 (25%)
Ig strand C' 185..187 CDD:409442 0/1 (0%)
Ig strand D 193..196 CDD:409442 0/2 (0%)
Ig strand E 200..205 CDD:409442 1/4 (25%)
Ig strand F 214..221 CDD:409442 2/6 (33%)
Ig strand G 224..234 CDD:409442 5/11 (45%)
Ig 242..350 CDD:472250 25/108 (23%)
Ig strand B 260..264 CDD:409363 1/3 (33%)
Ig strand C 273..277 CDD:409363 1/4 (25%)
Ig strand E 317..321 CDD:409363 1/3 (33%)
Ig strand F 331..336 CDD:409363 0/4 (0%)
Ig strand G 344..347 CDD:409363 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..427
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.