DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sls and Cd22

DIOPT Version :9

Sequence 1:NP_001261304.1 Gene:sls / 44013 FlyBaseID:FBgn0086906 Length:18468 Species:Drosophila melanogaster
Sequence 2:NP_001100973.1 Gene:Cd22 / 308501 RGDID:1311610 Length:852 Species:Rattus norvegicus


Alignment Length:997 Identity:196/997 - (19%)
Similarity:345/997 - (34%) Gaps:267/997 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly 16844 IEKLQPIHTPDGYTVQFECKVEGNPRPQ-----IAWFRETAIIKPSQDF--QMFYDDDNVATLII 16901
            :|..|.:...:|..:|..||.: .|:|:     |..|:.......::||  ::.|  :|....|.
  Rat    26 VEHPQTLFAWEGACIQIPCKYK-VPKPRSRLDSILLFQNYTFDNTTRDFTGKVLY--NNTKASIE 87

  Fly 16902 REVFPEDAGQFTVVAKNAAGFTSSTTELIVESPLSDHGSDATALSRRSMSRESSLADILEGIPPT 16966
            .|::.....:.|.:     |..|:...|.:: |:  |.:|:..|..|.:|.....   :|.|...
  Rat    88 TELYFSQQDRVTFL-----GNRSNNCTLKID-PI--HANDSGKLGLRLISGTDKW---MEHIHLN 141

  Fly 16967 FSKKPKAQYVD------ENTNVILECRLVAV---PEPDIVWTFNGEDID------EEEIKNVRIV 17016
            .|::|...|:.      |:..|.|.|.|...   .:..:.|:.:|.::.      ...::||  .
  Rat   142 VSERPFQPYIQLPSEIRESQRVSLTCGLNFTCFGYDISLRWSLDGSEVSPVTSSITSSVENV--Y 204

  Fly 17017 TESDM-----------HMYCSVVHISKVKKSQEGTYEVIATNREGEARLPITLKVRTTDKEAPQI 17070
            |||.:           .|.|.|.|.|:|...:                     .||...|..|::
  Rat   205 TESKLTFQPKWTDHGKSMMCQVWHFSQVLSER---------------------TVRLDVKYTPKL 248

  Fly 17071 LEPLRNMVIREGESVVLSTQIVGNPP----PKVTWYKDGKPVKNAKSDKDLHTLTLITPQKSEKG 17131
            ...:....::||.||.::.|:..:.|    .||:|:|||..:|..:..::   |||.:..|..:|
  Rat   249 QITVNPTEVKEGNSVTMTCQVNSSNPSLSTKKVSWFKDGSFLKEQQEQEE---LTLHSVTKDMRG 310

  Fly 17132 EYTVKAVNPLGSVET-TANLTIEEPAGGNAEPPLFVERFEEQNVPQKGEIRLPAKVSGNPVPEVQ 17195
            :|..:|.|.:|..:: ...||:..|                   |:      |:||...|.|   
  Rat   311 KYQCRASNNIGQGQSKEVALTVLYP-------------------PE------PSKVHIYPSP--- 347

  Fly 17196 WLFNNTPLFPSERIQQVYDGENIELIIKD-ANPET----------------------------DS 17231
                            ..:|:::|||... |:|..                            .:
  Rat   348 ----------------AEEGQSVELICDSLASPRATNYTWYHNGEMVPGASHEKLQISNVSLWHA 396

  Fly 17232 GDYKCIASNPI--GKTSHGARVIVEVDEVTFTKKLKKTITIEEVQSLTLEC--ETSHVVTTKWFF 17292
            |.|.|:|.|.:  ||....|.:.|.......|..::....|.|..|:||:|  .:|:...||:.:
  Rat   397 GKYSCLAENRLGCGKIEQEAELDVHYVPKAVTTVIQSVTPIREGDSVTLDCRYNSSNPEVTKYEW 461

  Fly 17293 ----NGKELSGMDHRVVVEDGKTHKLVIRNTNLRDSGTYTCKVKKQETQSTVEVLQRKPDFIKVL 17353
                :|.|::....|:......:..:.....|.:.|.::...:........|::|       ||.
  Rat   462 SPQGSGSEVTPGVLRIQKATWDSPPIKCAACNYKCSWSFPVSLNVHYAPRAVKIL-------KVS 519

  Fly 17354 EDYEVTEKDTAILDVELT-TEATEVT--WYKDGEKITPENKNVEFIKDGKARRLVIRDVTIHDEG 17415
            ...|:......:|..:.: :..|||.  |.|:|          ..:::|  |.|....::..|.|
  Rat   520 PASEIHAGQHVLLQCDFSGSFPTEVRFFWKKNG----------NLVQEG--RYLNFSSISPEDSG 572

  Fly 17416 QYTCKIEGQ--ECSCE---LVVIELPPEI---VEPLNDVAVTKGENAVFEVELSKGDALVK--WF 17470
            .|.|.:...  |.|.:   |.|:..|..:   :.|.:  :|.:|:.|....|......:.|  ||
  Rat   573 NYNCMVRNSIGETSSQAWSLQVLYAPRRLRVSISPGD--SVMEGKKATLSCESDAHPPVFKYIWF 635

  Fly 17471 -KNGKEIVFNERIQLAIDGKKQSLRIVKAKPEDVGEYSVQVGEQTSKAKLTVEEPLVDFVIRLPD 17534
             .|.:::.|:          .|.||:...:.:..|.|..|...:....|   ..|....|...|:
  Rat   636 DANDQDLHFS----------GQKLRLEPLRVQHTGSYRCQGINELGTGK---SPPSTLTVYYSPE 687

  Fly 17535 ITLATKTTDAEFTVQLSQPDVEVTWCKKGKPIKPNQKHEVFVEGTVRRLVIHDASDEDAGEISCV 17599
            ...........|.:.:.   :...|   |..|:...||....:|         ..|..:|:...|
  Rat   688 TIGKRVALGLGFCLAIC---ILAIW---GMKIQKKWKHNRSQQG---------PQDNSSGQSFFV 737

  Fly 17600 AENVTSSTKLCVEELKLPPVITSDKDQTIKVKENDDVTFTVKYTGVPTPEA----CWTTRKVVIP 17660
            .......|:|          ....:.|.......||   ||.|..:..||:    ....|.   |
  Rat   738 RNKKARRTRL----------TEGPQSQGCYNLAMDD---TVSYAVLRFPESDTHGAGGARS---P 786

  Fly 17661 KSKRTIPTIDEQSAKLTIKKVVDDDEGEYTVKLVNPVGEAEASLHLVIMRKPTAPGTPQPLEIMH 17725
            .::...|.              |||...|:|.....:|:.|          ..:|..|:. |.:|
  Rat   787 ATQGPPPN--------------DDDTVTYSVLQKRNMGDYE----------NVSPNCPED-ESIH 826

  Fly 17726 DSITLYWKAPEDDGKSEIIEYI 17747
            .|..:.:.|.:.....|.::|:
  Rat   827 YSELVQFGAGKRPQAKEDVDYV 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slsNP_001261304.1 I-set 87..174 CDD:254352
Ig 109..175 CDD:143165
Ig 254..334 CDD:299845
I-set 255..344 CDD:254352
I-set 372..462 CDD:254352
Ig 390..463 CDD:299845
Ig 471..561 CDD:299845
I-set 471..560 CDD:254352
I-set 618..709 CDD:254352
Ig 645..705 CDD:143165
DUF1136 715..741 CDD:284093
IG_like 762..843 CDD:214653
Ig 779..835 CDD:143165
I-set 890..982 CDD:254352
Ig 918..979 CDD:143165
DUF1136 988..1014 CDD:284093
I-set 1024..1116 CDD:254352
Ig 1058..1113 CDD:143165
I-set 1158..1250 CDD:254352
Ig 1178..1246 CDD:143165
DUF1136 1256..1282 CDD:284093
I-set 1291..1380 CDD:254352
IGc2 1304..1372 CDD:197706
DUF1136 1388..1414 CDD:284093
I-set 1424..1515 CDD:254352
Ig 1442..1513 CDD:143165
DUF1136 1522..1548 CDD:284093
I-set 1558..1645 CDD:254352
IGc2 1571..1639 CDD:197706
DUF1136 1655..1679 CDD:284093
I-set 1691..1782 CDD:254352
IGc2 1718..1772 CDD:197706
DUF1136 1788..1814 CDD:284093
I-set 1824..1916 CDD:254352
IGc2 1838..1906 CDD:197706
DUF1136 1922..1948 CDD:284093
I-set 1958..2049 CDD:254352
Ig 1985..2044 CDD:143165
I-set 2089..2181 CDD:254352
IGc2 2103..2171 CDD:197706
DUF1136 2187..2213 CDD:284093
I-set 2222..2314 CDD:254352
IGc2 2236..2304 CDD:197706
DUF1136 2320..2346 CDD:284093
I-set 2356..2448 CDD:254352
Ig 2384..2445 CDD:143165
DUF1136 2454..2480 CDD:284093
I-set 2488..2580 CDD:254352
Ig 2516..2576 CDD:143165
I-set 2622..2714 CDD:254352
IGc2 2636..2704 CDD:197706
I-set 2754..2844 CDD:254352
Ig 2771..2840 CDD:143165
IGc2 2908..2974 CDD:197706
I-set 3029..3120 CDD:254352
Ig 3057..3116 CDD:143165
I-set 3130..3220 CDD:254352
Ig 3148..3219 CDD:143165
I-set 3263..3354 CDD:254352
I-set 3401..3493 CDD:254352
Ig 3429..3490 CDD:143165
I-set 3539..3630 CDD:254352
Ig 3556..3625 CDD:143165
I-set 3676..3767 CDD:254352
IGc2 3690..3758 CDD:197706
I-set 3811..3900 CDD:254352
Ig 3828..3899 CDD:143165
I-set 3954..4046 CDD:254352
Ig 3963..4042 CDD:299845
I-set 4092..4180 CDD:254352
Ig 4102..4172 CDD:299845
I-set 4394..4483 CDD:254352
Ig 4411..4480 CDD:143165
I-set 4497..4581 CDD:254352
Ig 4519..4580 CDD:143165
I-set 4604..4693 CDD:254352
Ig 4621..4691 CDD:299845
I-set 4702..4792 CDD:254352
Ig 4702..4791 CDD:299845
COG4372 4996..>5260 CDD:226809
I-set 6536..6622 CDD:254352
Ig 6554..6622 CDD:143165
Ig 6654..6725 CDD:143165
I-set 6743..6829 CDD:254352
Ig 6760..6829 CDD:299845
I-set 6841..6928 CDD:254352
Ig 6858..6927 CDD:143165
I-set 6942..7033 CDD:254352
IGc2 6957..7023 CDD:197706
I-set 7066..7157 CDD:254352
Ig 7084..7153 CDD:143165
IGc2 7224..7289 CDD:197706
Ehrlichia_rpt 14571..15030 CDD:118064
SH3_p47phox_like 16753..16807 CDD:212790
I-set 16841..16931 CDD:254352 20/93 (22%)
Ig 16858..16931 CDD:299845 17/79 (22%)
I-set 16965..17060 CDD:254352 21/120 (18%)
IGc2 16978..17050 CDD:197706 18/91 (20%)
I-set 17068..17152 CDD:254352 24/88 (27%)
Ig_2 17078..17152 CDD:290606 23/78 (29%)
IG_like 17170..17253 CDD:214653 20/113 (18%)
Ig 17180..17250 CDD:143165 18/100 (18%)
I-set 17260..17342 CDD:254352 16/87 (18%)
IGc2 17274..17331 CDD:197706 12/62 (19%)
I-set 17347..17432 CDD:254352 20/92 (22%)
IGc2 17367..17423 CDD:197706 13/58 (22%)
I-set 17437..17521 CDD:254352 17/89 (19%)
Ig <17468..17521 CDD:299845 12/55 (22%)
I-set 17528..17611 CDD:254352 14/82 (17%)
Ig 17553..17602 CDD:143165 9/48 (19%)
I-set 17618..17708 CDD:254352 18/93 (19%)
Ig 17635..17708 CDD:299845 16/76 (21%)
FN3 17712..17791 CDD:238020 8/36 (22%)
I-set 17813..17898 CDD:254352
Ig 17830..17894 CDD:143165
Ig 17922..17994 CDD:299845
FN3 17998..18090 CDD:238020
FN3 18098..18189 CDD:238020
FN3 18207..18298 CDD:238020
FN3 18307..18398 CDD:238020
Cd22NP_001100973.1 Ig 24..143 CDD:416386 28/130 (22%)
FR1 24..47 CDD:409353 6/20 (30%)
Ig strand A 24..28 CDD:409353 0/1 (0%)
Ig strand A' 31..35 CDD:409353 0/3 (0%)
Ig strand B 37..48 CDD:409353 4/11 (36%)
CDR1 48..56 CDD:409353 2/7 (29%)
Ig strand C 56..63 CDD:409353 2/6 (33%)
FR2 57..63 CDD:409353 2/5 (40%)
CDR2 64..95 CDD:409353 6/32 (19%)
Ig strand C1 65..68 CDD:409353 0/2 (0%)
Ig strand C2 71..75 CDD:409353 2/3 (67%)
Ig strand C' 79..82 CDD:409353 1/4 (25%)
FR3 96..129 CDD:409353 9/40 (23%)
Ig strand D 97..101 CDD:409353 1/3 (33%)
Ig strand E 106..114 CDD:409353 1/8 (13%)
Ig strand F 121..129 CDD:409353 2/7 (29%)
CDR3 130..132 CDD:409353 0/1 (0%)
FR4 133..143 CDD:409353 2/12 (17%)
Ig strand G 133..143 CDD:409353 2/12 (17%)
IgC1_CD22_d2 147..242 CDD:409532 21/117 (18%)
Ig strand B 163..167 CDD:409532 2/3 (67%)
Ig strand C 179..183 CDD:409532 0/3 (0%)
Ig strand E 207..211 CDD:409532 1/3 (33%)
Ig strand F 221..226 CDD:409532 2/4 (50%)
Ig strand G 235..238 CDD:409532 0/23 (0%)
Ig 246..334 CDD:416386 25/90 (28%)
Ig strand A 246..253 CDD:409353 1/6 (17%)
Ig strand B 260..270 CDD:409353 4/9 (44%)
Ig strand C 277..285 CDD:409353 3/7 (43%)
Ig strand C' 287..290 CDD:409353 1/2 (50%)
Ig strand E 296..303 CDD:409353 3/9 (33%)
Ig strand F 310..318 CDD:409353 3/7 (43%)
Ig strand G 321..334 CDD:409353 3/12 (25%)
IGc2 350..408 CDD:197706 11/57 (19%)
Ig strand B 354..358 CDD:409353 2/3 (67%)
Ig strand C 367..372 CDD:409353 0/4 (0%)
Ig strand F 398..403 CDD:409353 2/4 (50%)
Ig 424..>466 CDD:416386 10/41 (24%)
Ig strand A 424..431 CDD:409353 1/6 (17%)
Ig strand A' 435..439 CDD:409353 1/3 (33%)
Ig strand B 440..450 CDD:409353 4/9 (44%)
Ig strand C 457..463 CDD:409353 2/5 (40%)
IGc2 527..583 CDD:197706 14/67 (21%)
Ig strand B 530..534 CDD:409353 1/3 (33%)
Ig strand C 543..549 CDD:409353 2/5 (40%)
Ig strand F 573..578 CDD:409353 2/4 (50%)
IG 610..682 CDD:214652 17/84 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.