DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sls and Sspo

DIOPT Version :9

Sequence 1:NP_001261304.1 Gene:sls / 44013 FlyBaseID:FBgn0086906 Length:18468 Species:Drosophila melanogaster
Sequence 2:XP_017177063.1 Gene:Sspo / 243369 MGIID:2674311 Length:5197 Species:Mus musculus


Alignment Length:266 Identity:56/266 - (21%)
Similarity:91/266 - (34%) Gaps:63/266 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  3682 IKDNLDVPEGGPIHFDCRVEPVGDPT----MRIEWFYNGHVMATG-SRVHQLNDFGFIALDVDY- 3740
            |:|.....:|.|:       |||:|.    |.::|..:..|::.| ..|.:|:....|::.||: 
Mouse   296 IQDGEVSVKGQPV-------PVGEPQLLHGMSLQWQGDWLVLSGGLGVVVRLDRSSSISISVDHE 353

  Fly  3741 IYARDS---GEYTCRATNKW-----GTATTSAKVTCKGKHNIVYESQLPEGMTSEKLKELERGRI 3797
            .:.|..   |.|..|..:.:     |.||.:|......|        ||             |..
Mouse   354 FWGRTQGLCGLYNGRPEDDFVEPGGGLATLAATFGNSWK--------LP-------------GSE 397

  Fly  3798 PEAPKVVEEVFGPPKFTTQITSVTVDEAEAVRFECQVEPKTDPSLRVE-WYRNGKPLPSGHRYRN 3861
            |.....||..:|    ...:...|:.:.|||:.:.|.:......|... |..:|:..|..:....
Mouse   398 PGCLDAVEVAWG----CESLLGGTLTDLEAVKLQAQAQDMCHQLLEGPFWQCHGQVQPDEYHETC 458

  Fly  3862 IFDMGFVSLDILYVYGEDSG-------EYVCRAINNYGEDRTRATVSCKKLPTILLQNQVPRGMK 3919
            :|         .|..|..:|       |.||....||.:...|..:..........:...|.|..
Mouse   459 LF---------AYCVGATAGNGPEGQLEAVCATFANYAQACARQHIYVHWRKPGFCERVCPGGQL 514

  Fly  3920 RSDALT 3925
            .||.::
Mouse   515 YSDCVS 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slsNP_001261304.1 I-set 87..174 CDD:254352
Ig 109..175 CDD:143165
Ig 254..334 CDD:299845
I-set 255..344 CDD:254352
I-set 372..462 CDD:254352
Ig 390..463 CDD:299845
Ig 471..561 CDD:299845
I-set 471..560 CDD:254352
I-set 618..709 CDD:254352
Ig 645..705 CDD:143165
DUF1136 715..741 CDD:284093
IG_like 762..843 CDD:214653
Ig 779..835 CDD:143165
I-set 890..982 CDD:254352
Ig 918..979 CDD:143165
DUF1136 988..1014 CDD:284093
I-set 1024..1116 CDD:254352
Ig 1058..1113 CDD:143165
I-set 1158..1250 CDD:254352
Ig 1178..1246 CDD:143165
DUF1136 1256..1282 CDD:284093
I-set 1291..1380 CDD:254352
IGc2 1304..1372 CDD:197706
DUF1136 1388..1414 CDD:284093
I-set 1424..1515 CDD:254352
Ig 1442..1513 CDD:143165
DUF1136 1522..1548 CDD:284093
I-set 1558..1645 CDD:254352
IGc2 1571..1639 CDD:197706
DUF1136 1655..1679 CDD:284093
I-set 1691..1782 CDD:254352
IGc2 1718..1772 CDD:197706
DUF1136 1788..1814 CDD:284093
I-set 1824..1916 CDD:254352
IGc2 1838..1906 CDD:197706
DUF1136 1922..1948 CDD:284093
I-set 1958..2049 CDD:254352
Ig 1985..2044 CDD:143165
I-set 2089..2181 CDD:254352
IGc2 2103..2171 CDD:197706
DUF1136 2187..2213 CDD:284093
I-set 2222..2314 CDD:254352
IGc2 2236..2304 CDD:197706
DUF1136 2320..2346 CDD:284093
I-set 2356..2448 CDD:254352
Ig 2384..2445 CDD:143165
DUF1136 2454..2480 CDD:284093
I-set 2488..2580 CDD:254352
Ig 2516..2576 CDD:143165
I-set 2622..2714 CDD:254352
IGc2 2636..2704 CDD:197706
I-set 2754..2844 CDD:254352
Ig 2771..2840 CDD:143165
IGc2 2908..2974 CDD:197706
I-set 3029..3120 CDD:254352
Ig 3057..3116 CDD:143165
I-set 3130..3220 CDD:254352
Ig 3148..3219 CDD:143165
I-set 3263..3354 CDD:254352
I-set 3401..3493 CDD:254352
Ig 3429..3490 CDD:143165
I-set 3539..3630 CDD:254352
Ig 3556..3625 CDD:143165
I-set 3676..3767 CDD:254352 25/98 (26%)
IGc2 3690..3758 CDD:197706 19/81 (23%)
I-set 3811..3900 CDD:254352 19/96 (20%)
Ig 3828..3899 CDD:143165 16/78 (21%)
I-set 3954..4046 CDD:254352
Ig 3963..4042 CDD:299845
I-set 4092..4180 CDD:254352
Ig 4102..4172 CDD:299845
I-set 4394..4483 CDD:254352
Ig 4411..4480 CDD:143165
I-set 4497..4581 CDD:254352
Ig 4519..4580 CDD:143165
I-set 4604..4693 CDD:254352
Ig 4621..4691 CDD:299845
I-set 4702..4792 CDD:254352
Ig 4702..4791 CDD:299845
COG4372 4996..>5260 CDD:226809
I-set 6536..6622 CDD:254352
Ig 6554..6622 CDD:143165
Ig 6654..6725 CDD:143165
I-set 6743..6829 CDD:254352
Ig 6760..6829 CDD:299845
I-set 6841..6928 CDD:254352
Ig 6858..6927 CDD:143165
I-set 6942..7033 CDD:254352
IGc2 6957..7023 CDD:197706
I-set 7066..7157 CDD:254352
Ig 7084..7153 CDD:143165
IGc2 7224..7289 CDD:197706
Ehrlichia_rpt 14571..15030 CDD:118064
SH3_p47phox_like 16753..16807 CDD:212790
I-set 16841..16931 CDD:254352
Ig 16858..16931 CDD:299845
I-set 16965..17060 CDD:254352
IGc2 16978..17050 CDD:197706
I-set 17068..17152 CDD:254352
Ig_2 17078..17152 CDD:290606
IG_like 17170..17253 CDD:214653
Ig 17180..17250 CDD:143165
I-set 17260..17342 CDD:254352
IGc2 17274..17331 CDD:197706
I-set 17347..17432 CDD:254352
IGc2 17367..17423 CDD:197706
I-set 17437..17521 CDD:254352
Ig <17468..17521 CDD:299845
I-set 17528..17611 CDD:254352
Ig 17553..17602 CDD:143165
I-set 17618..17708 CDD:254352
Ig 17635..17708 CDD:299845
FN3 17712..17791 CDD:238020
I-set 17813..17898 CDD:254352
Ig 17830..17894 CDD:143165
Ig 17922..17994 CDD:299845
FN3 17998..18090 CDD:238020
FN3 18098..18189 CDD:238020
FN3 18207..18298 CDD:238020
FN3 18307..18398 CDD:238020
SspoXP_017177063.1 VWD 229..378 CDD:214566 21/88 (24%)
C8 434..505 CDD:370094 14/79 (18%)
TIL 509..564 CDD:366828 4/12 (33%)
VWD 593..753 CDD:214566
C8 791..863 CDD:214843
TIL 866..919 CDD:366828
VWD 1054..1201 CDD:365869
C8 1245..1311 CDD:370094
TIL 1315..1371 CDD:366828
LDLa 1416..1451 CDD:238060
LDLa 1456..1490 CDD:238060
LDLa 1492..1526 CDD:238060
LDLa 1532..1563 CDD:197566
Ldl_recept_a 1603..1639 CDD:365841
TSP1 1737..1788 CDD:214559
TIL 1857..1908 CDD:366828
TSP1 1952..2005 CDD:214559
FA58C <2142..2262 CDD:330301
LDLa 2275..2309 CDD:238060
LDLa 2414..2448 CDD:238060
LDLa 2471..2505 CDD:238060
TSP1 2565..2617 CDD:214559
TIL 2640..2682 CDD:366828
TSP1 2725..2774 CDD:214559
TSP_1 2841..2889 CDD:365867
TIL 2893..2952 CDD:366828
VWC_out 2954..3001 CDD:214565
TSP1 2994..3045 CDD:214559
TIL 3097..3149 CDD:366828
TSP1 3193..3256 CDD:214559
TSP1 3262..3314 CDD:214559
TIL 3322..3372 CDD:366828
TSP1 3418..>3458 CDD:214559
TSP1 3482..3526 CDD:214559
TIL 3536..3592 CDD:366828
TSP1 3655..3699 CDD:214559
TSP1 3832..3884 CDD:214559
TSP1 3901..3949 CDD:214559
TSP1 3967..4020 CDD:214559
TSP1 4025..4077 CDD:214559
TIL 4080..4135 CDD:366828
TSP1 4180..4230 CDD:214559
TSP1 4274..4325 CDD:214559
TSP1 4389..4440 CDD:214559
TIL 4444..4499 CDD:366828
TSP1 4639..4687 CDD:214559
TIL 4701..4747 CDD:366828
TSP1 4791..4840 CDD:214559
TIL 4842..4896 CDD:366828
TIL 4948..5006 CDD:366828
VWC 5008..5063 CDD:327433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.