DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sls and obscn

DIOPT Version :10

Sequence 1:NP_001261304.1 Gene:sls / 44013 FlyBaseID:FBgn0086906 Length:18468 Species:Drosophila melanogaster
Sequence 2:XP_031759555.1 Gene:obscn / 101730564 XenbaseID:XB-GENE-957361 Length:9892 Species:Xenopus tropicalis


Alignment Length:11051 Identity:2067/11051 - (18%)
Similarity:3620/11051 - (32%) Gaps:3708/11051 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PVF---EQIFKNARFAQGGNALFEGRLRGNPKPFVTWTRKGAPLLESQKFRMSYNEATG-DVSLL 147
            |||   |::.|..:.....:|.....: ...|..|.|.:.|..:..|::.::   |:.| ...|:
 Frog   837 PVFSNQEKVQKEVQATLTESATLSCEV-SQAKTEVKWYKDGKLITSSKRVKV---ESEGRSRRLV 897

  Fly   148 INQIGPGDEGEYTCTARNQYGEAIC--SVYIQPEGAPMPALQPIQNLEKNI-------------- 196
            :.|:...|.|||:|.|.   ||.|.  ...|:||    ||...|..::|.:              
 Frog   898 VEQLEKKDAGEYSCEAA---GEKISFRIKVIEPE----PAFSNIDKVQKEVQATLTESATLSCEV 955

  Fly   197 ---------YSNGYSYTSIEEEFRVDTFEYRLLREVSFREAITRRS------GYEQDS---QLSQ 243
                     |..|...|| .::.||::       |...|..:..::      ||..::   ::|.
 Frog   956 SQAKTEVKWYKEGKLITS-SKKMRVES-------EGKSRRLVVEKTEKQDAGGYTCETAGQKISF 1012

  Fly   244 ELDRNQGPAQAPQISQKPRSSKLIEGS---DAVFTARVGSNPKPRLTWFHNGQRLVASQKYEISY 305
            :::..:   ..|......:..|.::.:   .|..:..| |..|..:.|:..|:::.:|::..:..
 Frog  1013 KINVKE---HEPAFINTDKIQKEVQATLNESATMSCEV-SQAKTEVKWYKEGKQITSSKRVRVES 1073

  Fly   306 SSGVATLRVKNATARDGGHYTLLAENLQGCVVSSAVLAVEPAAETAYEPKPV----DVMAEQLEA 366
            ......|.|:....:|||.|:        |..:...:..:.:.:   ||:|.    |.:.::::|
 Frog  1074 EGKSRRLVVEKVEKQDGGEYS--------CEAAGQKIHFKVSVK---EPEPTFANQDKVQKEVQA 1127

  Fly   367 GKALPPAFVKAFGDREITEGRMTRFDCRVTGNPYPEVFWLINGRQVRDDASHKILVNESG-SHSL 430
                           .:||.  ....|.|: ....||.|...|:.:  .:|.|:.|...| |..|
 Frog  1128 ---------------TLTES--ATLSCEVS-QAKTEVKWYKEGKLI--TSSKKMRVESEGKSRRL 1172

  Fly   431 MITNVTRLDAGAVQCLARNKAGEVAIEAQLNVLEKEQVVAPQ-FVQR--FSTMTVREGEPITMSA 492
            ::..|.:.|||...|.|   ||: .|..::|:.|.|.|.|.| .||:  .:|:|    |..|:|.
 Frog  1173 VVEKVEKQDAGEYSCEA---AGQ-KISFKINIKEPEAVFANQEKVQKEVHATLT----ESATLSC 1229

  Fly   493 NAIGTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTA------------ 545
            . :...:..:.|.|||..|:|:....:..:|.:..|.:.:|...|||.|.|.|            
 Frog  1230 E-VSQAKTEVKWYKDGKLITSSKRVKMESEGKSRRLVVEKVDKQDAGEYSCEAAGQKINFKIHVK 1293

  Fly   546 -------------QNIAGSTANRARLYVEVPREQPN---YEQRRL-NLPRPTKVIEP-------- 585
                         :.:..:....|.|..||.:.:..   |:..:| ...:..||:..        
 Frog  1294 EPEAVFTNLEKVQKEVHATLTESATLSCEVSQAKTEVKWYKDGKLITSSKKMKVVSEGKSCQLVV 1358

  Fly   586 EPI------------PGPEIIYLRHVERAKPHLRPGEEDRVYPPPQFIIPLQNVQQT--EGGRVH 636
            |.:            .|.:|.:..||:..:|...  ..|:|.         :.||.|  |...:.
 Frog  1359 EQLEKKDAGEYSCEAAGQKISFKIHVKDPEPAFT--NTDKVQ---------KEVQATLNESATLS 1412

  Fly   637 MEARIEPVGDPTMVVEWYLNGRPLAAS--ARATSVFKFGFIALDLLSIMGHDSGEYMCRV----- 694
            .|     |......|:||..|:.:.:|  .|..|..|...:.::  .:...|.|.|.|..     
 Frog  1413 CE-----VSQAKTEVKWYKEGKLITSSKKMRVESEGKSRRLVVE--KVEKQDGGGYTCEAAGQKI 1470

  Fly   695 -------------TNASGV-AESRAILSVVQRPSIEQSSQNPNSLQY-INQLEDYSRYQRTESID 744
                         ||...| .|.:|.|:.....|.|.|........| ..:|...|:..|.||..
 Frog  1471 NFKINVKEPEPAFTNIDKVQKEVQATLTESATLSCEVSQAKTEVKWYKEGKLITSSKKMRVESEG 1535

  Fly   745 EQLNQAPQFIRPLRDLGEFE---EGKNVHF-------------------EAQVT---------PV 778
            :......:.:.. :|.||:.   .|:.::|                   |.|||         .|
 Frog  1536 KSRRLVVEKVEK-QDAGEYSCEAAGQKINFKINTKEPEPAFTNIEKVQKEVQVTLNESATLSCEV 1599

  Fly   779 NDPSMRVEWYKDGLPITASSRITAIFNFGYVSLNILHLRAEDAGTYTVRAVNRIGEAIS------ 837
            :.....|:|||:|..||:|.|:..........|.:..:..:|||.|:..|.   |:.||      
 Frog  1600 SQAKTEVKWYKEGKLITSSKRVRVESEGKSRHLVVEKVEKQDAGEYSCEAA---GQKISFKINTK 1661

  Fly   838 --------QSSIRVHSRSQVT--ADLGIPEQQRYIE----------------KVEE--------L 868
                    |..::...::.:|  |.|.....|...|                :||.        :
 Frog  1662 EPEPVFANQEKVQKEVQATITESATLSCEVSQAKTEVKWYKDGKLITSSKRVRVESEGKSRRLVV 1726

  Fly   869 EDYRKSQQRRHVQEAA-------------EAIAPPQFKTPIQNQLDLREHAHAHFEARLEPVGDS 920
            |...|.....:..|||             |.:...|.|...:.|..:.|.|....|     |..:
 Frog  1727 EKVEKQDAGEYSCEAAGQKISFKINTKEPEPVFANQEKVQKEVQATITESATLSCE-----VSQA 1786

  Fly   921 TMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQDTTVAQLTVISK 985
            ...|:|.|||:.:.:|.|:..........|.::::...|||.|:|   .|.||..:.        
 Frog  1787 KTEVKWYKDGKLITSSKRVRVESEGKSRRLVVEKVEKQDAGEYSC---EAAGQKISF-------- 1840

  Fly   986 NEIVSESQHP--GGLQKIQHLEDSSRYGRREEEETYITQAPRFLGPLKGTTKILEGQRAHFEARV 1048
             :|.::...|  ...:|:|           :|.:..||:           |..|..:  .::|:.
 Frog  1841 -KINTKEPEPVFSNKEKVQ-----------KEIQATITE-----------TATLSCE--VYQAKT 1880

  Fly  1049 EPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQAT 1113
            |        ::||.:|:.|::..|::...:.....|.:.:|..:|||.|...|      |.|:.:
 Frog  1881 E--------VKWYKDGKLISSGKRVRVESEGKSRCLVVEKVEKQDAGEYSCEA------AGQKIS 1931

  Fly  1114 MIVETRSSIDTSSMHRGLYEKTQNLENKPFVEPQYDIEEISKSKPVFVTPLSDPKPIHDGKNIHL 1178
            ..:.|:......:..    ||.|........|......|:|::|                     
 Frog  1932 FKINTKEPEPVFANQ----EKVQKEVQATLTESASLSSEVSQAK--------------------- 1971

  Fly  1179 ECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNH----- 1238
                       ..|:|:.:|:.:|...|.|...:.....|.:.|....|:|||:..|...     
 Frog  1972 -----------TEVKWYKDGKLITSSKRVRVESEGKSRRLVVEKVEKQDAGEYSCEAAGQKINFK 2025

  Fly  1239 LGTAHTSA---------CVRVIDHTDVVTETQNEQSLEQIQLLEDSR------------------ 1276
            :.|....|         .:.|.:..|::.:|..:....:::..:|.:                  
 Frog  2026 INTVEPQARFLKPSKQEPILVQEDEDIILKTSVQPENTEVKWFKDGKELMATKKYQISSEGATRT 2090

  Fly  1277 ------------------RRHHQEEDITIMQAPQ-FTRGLHNIETIEGTNVHLECRL-QPVGDPS 1321
                              ....||..:.:.:.|| |.:.|..:....|:|:.|.|.| |..||  
 Frog  2091 LVVKLAESKDSASYSCTTNSDKQEFKVQVKEIPQKFQKKLEAVTGEIGSNITLTCELSQAKGD-- 2153

  Fly  1322 MRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEA-VTSCSVRII-- 1383
              :.|..|||.:|.|..|:...:.....|.:.|....|.|.|:|::|:....| :|:.:.|::  
 Frog  2154 --VIWRRNGKEIKAGKHFQMRSDEAKHILTISGLKVDDEGEYSCESRDDKTVAQLTTKAPRVVKF 2216

  Fly  1384 --AKNDLILETQNESGLQKIQYLEDS-----------------------TRHRRSEFVDEVV--- 1420
              ...::::|...|:.|:.:..|:|:                       |.|  |..:.|::   
 Frog  2217 TGELGNVVVEEGGEATLKCVLSLDDAEVTWYRNGVKIESNKKYTINKKGTNH--SLTIKELILQD 2279

  Fly  1421 -----------------NIRPRFLTHPKSLTNT--REGGHAHFECKIEPVTDPNLKVEWFKNGRP 1466
                             .:|.:..|..|.|.||  .|.....||.::...|:   :|:|.:|...
 Frog  2280 AGEIMAESEGIQTKASLKVREKPTTFKKKLENTTVEERQTVRFEVELSKATN---EVKWMRNSIV 2341

  Fly  1467 ITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQVEL-------QCRSGEQIVT 1524
            :..........:.....|.:.:::..|.|:|.|..::    |:||.:|       :...|.:.|.
 Frog  2342 LQPSENIEIQSEGTKQILILKNVMYTDRGLYGCETLD----DKTQAKLNVEMRQVKVAKGLKDVE 2402

  Fly  1525 VTQNEAG---LEQIHYLEDRSRYTRRE--------------------------EIDES------- 1553
            |.:.|:.   ||..|  ||...|..::                          ::|:|       
 Frog  2403 VHEKESATFELELSH--EDVEGYWMKDGIKLKPSDTCKMTVKGKKHSLTLSSLKMDDSGPVAFKS 2465

  Fly  1554 ----------TKQAPV-FTTSLKNVEIKENQRAHFECRLIPVSDPSMRVEWYHNNLPLKSGSRFT 1607
                      .|:.|| .|..||:::..|.::..|||.   ||.|:..|:|:.:...||...:..
 Frog  2466 EGLQSTAKLTVKEPPVKITLPLKDIKAPEKEKVTFECE---VSRPNAEVKWFKDGSVLKPSKKVA 2527

  Fly  1608 ETNNFGFVALDIMSTLPEDAGTYTCRAYNAVGEAITSAVAVVHTKKSIYLESQHETALPRLQHLE 1672
            ..:.....::.|.....||.|||.|.|    |:..|||...||.:                    
 Frog  2528 IISQAKKRSVTIHKCEHEDQGTYVCDA----GDDKTSANLTVHAR-------------------- 2568

  Fly  1673 DGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASN 1737
                    .:|         ...|:.||.|.|.:...|   :..:...::..:|.:||..::|.:
 Frog  2569 --------DIQ---------IIKPLVDVEVVEKEGASF---MCQISHDEVQTQWYKNGVKLKAGD 2613

  Fly  1738 RTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSASLIVQSKTSIQLETQHEAAMHKIH 1802
            ......:....:|..|.|..||:                       ::.....||....|..||.
 Frog  2614 NVKMRQEGRTCSLVFKSVQAEDA-----------------------AEIKFVAETAESRAQLKIK 2655

  Fly  1803 QLEDHSRYQRREEEEYTVTTAPVFVTKLIGPSNLVEGQSAHYECRIEPYPDPNLKVEWFHNGKPL 1867
            :|                   ||.:.|.:.....:|...|..||::.   ..:.:|.|:...|.:
 Frog  2656 EL-------------------PVKIVKPLRDKIAIEKHRAFLECQVS---RASAEVTWYKKNKQI 2698

  Fly  1868 STGHRFRTTYDFGFAALDILTVYAEDSGEYTCRVTNNLGEA---INSIVLNVTSRSSIIHETQHE 1929
            :.|.::.......:..|.|.....||...|||...::...|   |....:|:......:..||.|
 Frog  2699 APGDKYEIVSQGVYRKLIINEAEFEDEDTYTCDAGDDKTSAKLLIEEQSINIVKELEDVVVTQPE 2763

  Fly  1930 ----EALTKI------------QHLEDTSRFQ------------RKTDEE-----QFH------- 1954
                |.:|.|            :.|.|.....            |||..|     |||       
 Frog  2764 PATFECVTSIVSVKPPKWMLGGEVLSDGKGITIEQDGTIHRLTLRKTSPEMSGTLQFHIGKSKSS 2828

  Fly  1955 -----AERP-QFGRPLRNAKVNEGAPVHLEATLIPVNDPTMKVEWYCNGRPIQTGHRFKTTYDFG 2013
                 .|.| |....:.:...||...|.|.....|   |...|||:.:...::...|||...:..
 Frog  2829 ANLLVKEIPVQVTYRIEDKTANERQTVILSCEFKP---PPKFVEWFKDKSQVEPSERFKLKLERN 2890

  Fly  2014 FVALDILYAHAEDTGTYMCKAKNAIGEAVTTCAVNVTA--------------------------- 2051
            ...|.||....||:|||.|||    |:|.|:..:||.|                           
 Frog  2891 VAELKILQVTPEDSGTYTCKA----GDAETSGKLNVHARDVKVLKPLKDVEVDEESCAGFSCELS 2951

  Fly  2052 ----------NKTL-------DLDTLDAQRLEKIRQLETYAPPPKPVVEEKGQKPIFLTPLSNLE 2099
                      |.||       |:..:.|.....::|:   ||.....|..|.:|..|...|.   
 Frog  2952 HDDEEVEWFLNNTLLYSNNFNDIQKIGATHTLTLKQV---APEDSGTVSVKTKKLSFSAQLK--- 3010

  Fly  2100 HLKE-------------GEH---AHLECRVEPINDPNLKIEWFCNGKQLPTGHRYRTTHDFGYVA 2148
             :||             ||.   ..|||.|   :...:|..|..:.:.||.|.:|:.......|.
 Frog  3011 -VKEKPAVFMKSLDDAVGEERGMVTLECEV---SKAKVKPVWKKDNQVLPNGDKYQQMQAGKTVC 3071

  Fly  2149 LDILYVYGEDTGTYICKATNQLGEAVNTCNVRVLNRRSMILDTQHPDALEKIQKLESKVPNARTE 2213
            |.|..:...|.|.|:|    .:|                 .||           .:||:......
 Frog  3072 LIIHDLNKSDAGLYVC----DIG-----------------TDT-----------AKSKISVQELN 3104

  Fly  2214 VGDAPISPPHFTAELRGSTEIYEGQTAHFEAQVAPVHDPNLRIEFYHNGKPLPSASRFHITFDFG 2278
            :|        .|..|: |.|..||::..||..::  |:......:..||:.:....||:::....
 Frog  3105 IG--------ITKRLK-SCEAKEGESCTFECILS--HESIDECSWTVNGQSVEGDKRFNVSNKGR 3158

  Fly  2279 YVSLDITHAVAEDAGE--YSVRAVNALGQAVSSTNLRVIPRGTIISDTQHPEGLEKIRKLESTAP 2341
            ...|.|....|.||||  ::.|.:|      |..:|.:                           
 Frog  3159 KYVLSIKEVRARDAGEVVFTARNLN------SKASLTI--------------------------- 3190

  Fly  2342 HQRQEPETPGTRQRPV-FTQPLQNIDRINEHQTAHFEARLIPVGD----------PNLKVEWYRN 2395
                       :::|. .|:||              |.:.:|||:          .:..|:|.::
 Frog  3191 -----------KEKPAEITKPL--------------EDKTVPVGEDIVLRCELSKEDTNVKWSKD 3230

  Fly  2396 EKIIEDSSRITKQHDFGFVSLDISHIRKEDEGVYMCRAVNPLGEAVTTASMRVVSEASIQMDTQH 2460
            .|:::.|.:.....:.....:.|..:..:|.|.|.|..      :::.....|..:..:...|:.
 Frog  3231 GKVLKKSQKYEFFQEGTETKMTIHEVTAKDSGEYTCET------SISKTKANVQIKEKLNSFTKE 3289

  Fly  2461 PDSISRIHQLEKPLAPRPTEPERLFEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSLKFEWF 2525
            ...: :|.:.|..:....||.             ..||..|.        :.:....||.|:|..
 Frog  3290 MSDV-KIEEGESAVFSCETEK-------------VAPSVSWR--------KGITEIKPSEKYEIS 3332

  Fly  2526 INGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAGEAVSSTAMKVKTKSNI---D 2587
            ..|:.|               :|.:..:...|:.:|:|...:|            :||:|:   .
 Frog  3333 QKGIAL---------------SLQVNDLEKSDSDIYICDIRDA------------QTKANLTVKG 3370

  Fly  2588 GQPLIPESWEAIRLKEAAMNRVPEMFVDSTPQQAPVFTTHLQSYDKLHEGQHVLLEAQVEPRADP 2652
            .:.||.|..|.|                                 :::||:....:.::.|....
 Frog  3371 HKVLIVEDLEDI---------------------------------EVYEGESATFKCRISPAHYR 3402

  Fly  2653 NLRIEWFKNGISLTTG--SRIRSTFDFGLVTLSINGLRADDSAIYTCKATNQVGEAVSTSSLKIE 2715
            |  ::|..:...|.|.  :.|::..| |..|||:..|...|..:.|.:|.||    .|:.:|.::
 Frog  3403 N--VQWSLDKTPLHTNDVNEIQAHPD-GYHTLSLKQLSLKDCGVVTFEAGNQ----KSSVNLVVK 3460

  Fly  2716 DRHWLQAESLHPDSLPRIGELEAPKEGRPEAPEPTYETPVFITH-LNNIECKESDNVRFECNVEP 2779
                                                |.|..||. |::.|..|.:||...|....
 Frog  3461 ------------------------------------EKPCIITKALSDCEVTEGENVTLHCKTSK 3489

  Fly  2780 ARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYC--ALDLTNSYAENSGVYTCKATNSKGSATTSGT 2842
            |..   |::|:.:|:.|:.::||:  .|...|  :|.:.|:...:||.|.|:...||.||..:  
 Frog  3490 ANG---SVKWYKDGKVLRPSSKFQ--IDRSGCEASLVICNAMGIDSGTYVCEFGTSKTSAVVA-- 3547

  Fly  2843 LKCTGGKTMFLDTQHPQG--EAGLEAVQETEEELANRYTSKTTKPETQYPPPVWTKPLQAEFHLS 2905
                        .:.||.  :..|::.:..|.|.|.                :|.:       ||
 Frog  3548 ------------VKAPQAYFKRELQSAEAVEGETAT----------------LWCE-------LS 3577

  Fly  2906 EAQPIHLEANVEPKEDPNLFIEWYFNGKMLNHGSRFKMTSEFGFVTMDMIEVYARDQGIYTCKAY 2970
                           :||..:||..:|.:|....:.:|..:...|.:.:..:...|.|.|.|   
 Frog  3578 ---------------NPNAEVEWSKDGNVLKASKKHEMRVKDHRVELLIHHLVEEDAGTYIC--- 3624

  Fly  2971 NKAGEAFTSTTIFCSSKENIIESTQHPKGAEGLEQIQDLEDSLRKDGSKPEQPDLGIPPRFTTEF 3035
             ..|:..:|.|:...:                 ||:      |.|.|.:.|:...|         
 Frog  3625 -ATGDRKSSATLTVKA-----------------EQV------LFKRGLRNEKAKEG--------- 3656

  Fly  3036 VNIADIGEGELAHFEANLIPVGDQSMVIEWFYNGKVLEASHRVRTIYAFGTVA-LEVLGTKIEDT 3099
                  |..:| |.|     :...|..:.|....:|||...:. .:...|.|| |.:|..|.||:
 Frog  3657 ------GSVKL-HCE-----LSKASGSVRWMKGSQVLENGDKY-NMKLLGAVAELFILNAKPEDS 3708

  Fly  3100 GTYTCRATNKHGTAEISCNLECVDKPRGQKPRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKV 3164
            |.|||...::..||.::.....|        ||...::..| :::|.|....|   .|..||..|
 Frog  3709 GDYTCDTGDQKSTAHVTVTALPV--------RFKQDLKDAE-VEEGSSVTLSC---EVTKPDAPV 3761

  Fly  3165 EWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTRTTLNCGGRGGVF 3229
            .|......::.:.:.:.......|.|.|..:...|||.|.|..    |:..|...:.......:|
 Frog  3762 TWKKGVTTLQANEKYEFRQKECLVDLTIHKVGPEDSGTYTCDT----GDQQTSARVKVKELPALF 3822

  Fly  3230 YDSLQPDSLQR--------------------------------------------IREL------ 3244
            .:.|:|..:..                                            ||:|      
 Frog  3823 KEGLKPQQVSEGECAALRCELTKANVSVEWKKDHRMIKQSKKYKIRQEGAVSELVIRDLVLEDSG 3887

  Fly  3245 --ECPQGQQADTSAPLV-AEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKL 3306
              .|..|:|..|:|..| |.||:|..::.| .|..|||.|.....|   |.|..|:||......|
 Frog  3888 DYSCVCGEQKTTAAVTVAASPPRFSEELKD-EKATEGQQATLHCEL---TKPGAVLEWKKGQSSL 3948

  Fly  3307 PHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRASLK----------------C 3355
            ..|.::....:.....|.|....|.:||.|....    |...|.|:|.                .
 Frog  3949 KPGGKYSMRQEGFSAELLISNLEESDSGDYTCEC----GNQQTTATLTVNALPVFFKKNLRDAVA 4009

  Fly  3356 ASKSSLILDSQLP---------------RGMEGGLEKIANL---------------EYSMVRTRE 3390
            ..:.::.|..:|.               :|.:....||.:|               :|:.:...:
 Frog  4010 TEEETVTLHCELSKPTTNVEWKKGHRQLKGSDKYTMKIEDLVAELIIHDLNVKDSGDYTCLCGDQ 4074

  Fly  3391 ETTEE-TKGKAPV-FTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTF 3453
            :||.. |....|: |...|.| |...|||.......:|...|   .|||....|.|:...::...
 Frog  4075 DTTANLTVNALPILFKEELSN-EESTEGETVTLRCILTKPPD---HVEWKQGQRALRPSPKYEMR 4135

  Fly  3454 CDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTATMKIQGKRSIIMESQLPKGMEGTIDRIAE 3518
            .|.....|.|..:..:|.|||:|..    ||..|||.:.:..     :.:....|::.  :.|.|
 Frog  4136 VDGATAELIIHHLEVKDMGEYACVC----GEQQTTAVLIVNA-----LPTHFKHGLKN--ENIKE 4189

  Fly  3519 LEGLGSRSTEFVPDDDTGKPPEFITSPFDMVIGENALAHFECRLQPINDPSMRVDWFHNGKALWA 3583
                                            |:.|:.|.|     ::.|.:.|.|..||:.|..
 Frog  4190 --------------------------------GDQAILHCE-----LSKPDVTVQWRKNGEVLAT 4217

  Fly  3584 GSRIKTINDFGFVILEIAGCYQRDSGLYTCKATN--------------------KHGEA------ 3622
            ..:.....|.....|.:....:.|:|:|||...|                    |:.||      
 Frog  4218 SEKHVLRQDGAIAELVVPHVEEEDAGIYTCICGNVETSSTLTVIALPPRFKEDLKNSEAVEGDSI 4282

  Fly  3623 TVSCKLQVKGRQGIVMEPQLPSNFRTGTESLQKLEETMHKREELVTE------------------ 3669
            |:.|:| .|....:        .:|.|.::|:..::...::|.||||                  
 Frog  4283 TLRCEL-TKSNASV--------GWRRGGKALRPNDKYKMRQEGLVTELVISQLELQDAGKYTCVC 4338

  Fly  3670 -DEQPN--------PPKFTEEIKDNLDVPEGGPIHFDCRVEPVGDPTMRIEWFYNGHVMATGSRV 3725
             |.:..        ||:|.||::.. :..|||.:...|::.   .|...:|| ..||........
 Frog  4339 GDFETTALLTVNAVPPQFEEELRSK-EAMEGGSVALSCKLT---KPNAVLEW-RRGHKTLKSCDK 4398

  Fly  3726 HQLNDFGFIA-LDVDYIYARDSGEYTCRATNKWGTATTSAKVTCKGKHNIVYESQLPEGMTSEKL 3789
            :::|.....| |.::.:..:|:|||||..    |...|:|.:|....                  
 Frog  4399 YKINQEDLDAELIINNLDLKDAGEYTCVC----GVHQTTASLTVNAL------------------ 4441

  Fly  3790 KELERGRIPEAPKVVEEVFGPPKFTTQITSVTVDEAEAVRFECQVEPKTDPSLRVEWYRNGKPLP 3854
                                ||:|..::.:..|:|.|::...|::   |.....:||.:....|.
 Frog  4442 --------------------PPQFKVELKNKEVNEGESITLHCEL---TKAKALLEWRKEQSILK 4483

  Fly  3855 SGHRYR-----NIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRTRATVSCKKLPTILLQNQV 3914
            ...:|:     .:.::...:||:     :|:|:|.|..    ||.:|.|.::...||.:      
 Frog  4484 QSDKYKMKQDGKVAELLVCNLDL-----KDAGQYSCAC----GEQKTTAVLTVNALPIV------ 4533

  Fly  3915 PRGMKRSDALTQMEATIKKYTSEVHLTEDDLFDPDRKQPPRFVTQIKEQLTLTEMAVTKFECQLA 3979
                                                     |:.:::.::...:..:| ..|:|.
 Frog  4534 -----------------------------------------FIEELRNEIGTEDQDIT-LRCELN 4556

  Fly  3980 PVGDPNMKVEWFFNGKPLLHKNRFQPIYDFGYVAMNFGWVYPEDSGEYVCRATNLYGKDETRAII 4044
            ...:|   |.|..:.:.:...:::....|.|...:....:..:|:|.|.|    :.|..||.|.:
 Frog  4557 KHKEP---VVWKKDNREMKPSDKYIIQRDGGVAQLKILKLNVKDAGSYTC----ICGDQETTAKL 4614

  Fly  4045 KVSGKPGIVYDSQLPAHMQSIDRIREMEASWQVVPDEVDPDAKPRTKPVFVSKLEPQTVEEGDPA 4109
            .|         .:|||                                :||.:|:.....||..|
 Frog  4615 TV---------QELPA--------------------------------LFVEELQHTEEREGQKA 4638

  Fly  4110 RFCVRVTGHPRPRVMWLINGHTVVHGSRYKLTNDGMF-HLDVPKTRQYDTGKVEVIARNSVGESI 4173
            .|..|:| .|..||.|.....|:....:|:|..:|:. .|.:.|....|:|....:.    ||..
 Frog  4639 MFHCRLT-KPNARVEWKKGHETLKPNDKYQLRQEGVIAELTISKLDLKDSGNYTCVC----GEEA 4698

  Fly  4174 ATTELKVVARSDDYRNVLKNSPRPWYDYELAAYQKERQENELEKVF--DERKQVLSEQSSHTLK- 4235
            .|..|.|:                                ||..||  |.:...::|..:.||. 
 Frog  4699 TTATLTVI--------------------------------ELPAVFNSDLKNVEVTEGGTATLHC 4731

  Fly  4236 GVEHLKPKQYKPPTPDWQQNVKAKKSEDYYNKLQT-LETEQLLKETNLRRDTHQY-AIPGEKVVS 4298
            ||....      ....|.:..:|.:|.|.|:..|. ...|.|:.:|:| .|:.|| .|.|::..|
 Frog  4732 GVTKAS------ALVQWMKGKQALRSSDKYHMNQDGCAIELLICDTDL-DDSGQYTCICGDQKTS 4789

  Fly  4299 SS-QAKGMAQSYEENLQEKTSTTEVQAAPPK-GIAQPSESSVHGREVHMNKQQQV----QKEIQG 4357
            :: ....:...::|.| :....||...|... .:::|:......:..|:..|.|.    |:.:..
 Frog  4790 ATLTVNALPVVFKEEL-KNVEVTECDTATLHCELSKPNVCVEWKKGTHVLSQSQKYSFRQEGLSA 4853

  Fly  4358 DL---EITRKITATETTEVEHKGTIQERVVQGPVKPAKAPVFTKKIQPCRVFENEQAKFEVEFEG 4419
            ||   .:..|.....|.....|.|  ..||...|.|.   :||::::.....|.|.|....|. .
 Frog  4854 DLVIHNVEPKDAGEYTCTCGDKKT--SAVVAVNVLPV---IFTEELKCAEATEGETAILHCEL-S 4912

  Fly  4420 EPNPTVKWYRESFPIQNSPDLQIHTFSGKSILIIRQVFVEDSAVFSCVAENRGGTAKCSANLVVE 4484
            :||..|:|.:....:::....|:....||..|:|..:.:.|:.|:|||.    |..|.:::|.|:
 Frog  4913 KPNVPVEWLKGGQVLKSGDRYQMQQSGGKVELLISNLELGDAGVYSCVC----GIEKTTSDLKVK 4973

  Fly  4485 ERRRAGKGGIQPPSFVTTIQSTTVATGQLARFDAKVTGTRP-LDVYWLKNGMKIQPSIKFKMLEE 4548
                     ..|..|...:|:|............:|  ::| ..|.|.|..:.:|...|::|.::
 Frog  4974 ---------ALPSVFTKALQNTEAQEDDTVTLRCEV--SKPNASVEWRKGSLGLQQGSKYEMRQK 5027

  Fly  4549 DSVHTLLIIEPFAEDSGRYECVAVNAAGEARCDGDCIVQS-PSKPEKPTTPGSEKAPHIVEQLKS 4612
            :.:..|:|.....||:|.|.|    ..|:........|:: |...:||              ||.
 Frog  5028 ERIAELIIHNLRLEDTGEYSC----DTGDQETRAYLTVKALPVLFKKP--------------LKD 5074

  Fly  4613 QTVEEGSKVIFRCRVDGKPTPTARWMRGENFVKPSRYFQMSRQGEYYQLVISEAFPEDEGTYKCV 4677
            .|||||..|..||... ||.....|.:|...:.|...::|.:.|...:||:.:|..||...|.| 
 Frog  5075 TTVEEGVTVTLRCETT-KPNVPIEWRKGSVGLFPCAKYKMVQDGVVAELVVYDAEAEDGDVYTC- 5137

  Fly  4678 AENKLGSIQTSAQLKV------RPIENLDAPPTITALKDVSVTEGMPAQFKTTVTGKVKATSVQW 4736
               ..|..||:|.:||      :|::|::|            .:|..|||:..::.  |..||:|
 Frog  5138 ---DTGDQQTTATVKVNVLQFLQPLQNMEA------------QQGEKAQFRCEISS--KKNSVEW 5185

  Fly  4737 FREGQLIPETPDFQMIFDGNSAVLLIGTTYEEDSGIFTVRVTSSTGQVESSAKLTVKK------- 4794
            .:..:.:..:..::|........|:|.....||:|.||....|.    :|||.|.||:       
 Frog  5186 RKGAETLQPSSKYEMKEQDGVRELVIHNLELEDAGEFTCVARSK----KSSAVLKVKELDVTIVK 5246

  Fly  4795 --RRISAF---------------------QLRTIDSAEDES---------------SSSGREDSA 4821
              :.:|.|                     :|:.|....:|.               ||..:||:.
 Frog  5247 GLKDVSVFAAEDAVFTCEVSHPDAKDVEWKLQGITLVNNEMNEISLEKGKIHRLKLSSVTQEDTG 5311

  Fly  4822 PESPHAFQPG----------QQPGQQFGQFLGVNGQGQHQGR-------SRQKKPKVRSKSLQPA 4869
            ..|   |:.|          :.|...|.:.| ::.|.:..|.       ||...|.|        
 Frog  5312 SVS---FRVGPYTSTAELTVKAPLPVFTKNL-LDMQVEEDGSVILECELSRPNVPVV-------- 5364

  Fly  4870 TKVIPWRKSSRP-TRGRSLD-------KGVFLPGFKPEPVKSW--------TEETINLKATPIEK 4918
                 |||.:.. ..|...|       ..:.:...|||...::        |:..:.:.|.|:|.
 Frog  5365 -----WRKGTEQIPAGAKYDIKEAGTVHSLQISNLKPEDSGAYSCDVGNQQTKAKVTVSALPVEI 5424

  Fly  4919 KKPAPKLEAAKVVLKSIKTERDQGIMSLGATLEQIIAGKTEKEAIP--WITMREKLKAVESVQQQ 4981
            .||               .:.:||    ..|...|:..:..|...|  |       |....|.|.
 Frog  5425 TKP---------------LQNEQG----EETKSVILRAEISKANAPVQW-------KKAGVVLQP 5463

  Fly  4982 LNKFDLD------EVYLQPLEGQIETEGQL-----PQQAQVEQVQRTKEIQRLKSMESVEIMEMT 5035
            .:|:::.      |:::..|  |:...|:.     .|::......:..|...:..::::.:.|..
 Frog  5464 GSKYEMKQAGHVVELHIHKL--QMSDAGEYTCDTGDQKSMANICVKEPEPFIVDHLQNISVEEGE 5526

  Fly  5036 DQIDKLITQQQNAKDLIPW---------KEMRQ-----------QLKSVQRVTKQIDKFKIEE-- 5078
            |.|.|....::||.| :.|         .||.:           .||.|......|..|::.:  
 Frog  5527 DAIFKCKVSKENAPD-VQWYLAGVPLQPNEMNEISVHKGKIHTLTLKKVSTEDTGIVSFRVGQNT 5590

  Fly  5079 --VELRHLQAQQAITEEYQTGTA-EETVVMID-ESSKGSI-------SKVLRRDEQLQYEDQSNI 5132
              .:||........|::.|...| ||.|.::. |.||.::       ||:::..||.:.....::
 Frog  5591 TTADLRVTAIALNFTKKLQAVEAMEEGVALLQCELSKVNVPVEWRKGSKIIKHGEQYEISVNGSV 5655

  Fly  5133 Y--KQKFITTED------------------VNIMHVS---EREKLEAQ---------RLIREQQA 5165
            :  :.|.:|.||                  ||.:.|:   |.:.:|.:         ::.|.:..
 Frog  5656 HTLRIKDLTLEDSGEYSCCAQSEKTSSQLQVNQLPVTFTQELQNVEPEEGGTAVLQCKVSRPEAH 5720

  Fly  5166 VNWRQQQQRPQLQPLTSVEDTVISQTSERQKLVQQQSFIEE--------------------AQRQ 5210
            |.||:...  .|||....|             ::|..|:.|                    ||..
 Frog  5721 VEWRKGGL--VLQPSAKYE-------------MRQSGFVVELLIHNLDLEDCGPYSCSTDAAQTS 5770

  Fly  5211 QFVQVEDSQMMSLEEYEHQKI-----------INQRTQQEAFSWRQPREPQ-------------- 5250
            ..|.|::..:..:...::..:           ::::..::|..|......|              
 Frog  5771 ASVFVQEGNLEIVTGLKNMDVFAGETATFTCKLSKQGTRKAQWWLDGSPLQNSSMNEISVLNGNI 5835

  Fly  5251 -----KFIQVEDSTLLHLQERHDTQEQQLLQQQPVMWDRGRKKPDQPQYVQPQEQRVKEEFVEKP 5310
                 |.:...||.::..:........:||.:.|.:           :.|.|    :|:..:::.
 Frog  5836 HTLTLKNLGTNDSGVVTFKAGSLISSAKLLIKDPTI-----------EVVSP----MKDLAIDED 5885

  Fly  5311 KTYEEMHDELVEPTPIEQPQPVPVMWERGKKKPQPQEKTFEEAHDELVEPTPVQQPEPVPVMWER 5375
            .|.|.:                                              .|...|....|::
 Frog  5886 DTAEFI----------------------------------------------CQYSRPAQARWKK 5904

  Fly  5376 --------GKKKVAQQETVLSQEVVQTSQVVEQQI----VEETKKTAVRRVIPPREPEQKVEQVT 5428
                    |::.|.:|:..:::..::::...:..|    .|.|:..|:..|....:..|::|.: 
 Frog  5905 NDLDVCADGERIVLEQDWNVAKLTIRSAVPEDSGIYVCEAEGTRVVAMLEVEAKNKVLQELENI- 5968

  Fly  5429 LKPTPRPRPKEAVKAEEIQL-----KPLRSTRPVPQPVEAEQKAYEEATDELTEEPIPQPQPVMW 5488
                      :||:..|...     ||             |...|....|:.........:.:.:
 Frog  5969 ----------DAVEGGEALFGCYLAKP-------------ESYNYNWLLDDEPARTSENIEMIYF 6010

  Fly  5489 ERGKK-----KPQKPQE--EVT----EIPKTLEIAVDTLEEEVPKPTEPQPQPVLWARGQKKPQK 5542
            |.|::     |...||:  .||    |...:..:.|.....||.||  |....|: |.||     
 Frog  6011 ENGRRHLLLLKNLTPQDSCRVTFIAGEAVTSAFLNVQGWRLEVVKP--PVDSEVI-AGGQ----- 6067

  Fly  5543 PDEQKQELPKSLEIAVDTIEEDLIKPVQPEPQPVLWERKKKKPQPQDVIEEKLDVAPTKTYEKAV 5607
                 .....:|..||...|             |.|                        |...:
 Frog  6068 -----ATFSCTLSEAVPVNE-------------VAW------------------------YFNGI 6090

  Fly  5608 DVLPDEPKVEEKPEPVLWQRGKKKIPKSEPTEEVHPDEVDAQIETVVKEDEMIVEEKRRIKKTKR 5672
            |:.|||.          |..                 :||.....::.:|..:.........::.
 Frog  6091 DIRPDES----------WAM-----------------QVDGNEYKLILKDAQLHHSGEVAFASRD 6128

  Fly  5673 PKSTKEVTEELFEEQPEEEISPEEEVPQKEVIEEIEEIVEEKRR---LKKTKKPK-----LTQQV 5729
            ..::.:::.....:.|||                 .|||.:..|   |.....|.     :....
 Frog  6129 IVASAKISVLALPDPPEE-----------------PEIVSKSSRSLTLSWFAPPSDGGSAILGYN 6176

  Fly  5730 TEEETPHEEIIKESEEVVQEQEEIVEE-------KKKVKKVKK---------PKTVAEKQLKEEE 5778
            .|.:.|..:..:.::|.:|..|.:|:.       :.::..:.|         |:||   || |..
 Frog  6177 VEIKAPGSDWKQCNKETIQTTEYVVDNLVPGEAYRFRISSINKHGAGEPVHLPQTV---QL-EHP 6237

  Fly  5779 IPTEETVEEEETAEDQ--QLVVEESKKVKKVKKPTGTVEKTDVEEL-PGEEVPVEEVPVEEVPED 5840
            :..:..:|.:...|.:  :|..|.||:.:.||...|:      |.| |||               
 Frog  6238 VTIKRPLENQSVKEGESIRLECELSKETRDVKWMKGS------ETLKPGE--------------- 6281

  Fly  5841 VAPEEELI---EEQEEIVDQDEIQEQKRKVKKAKKPKKTIEKTEIEIEEDQPEEEVLQEEIIGEQ 5902
               :.|.|   ::|..|:.....::|..........:||  .|.:.||:....|....:||.|  
 Frog  6282 ---KHEFISQGKKQVLIIHNGSSEDQGSYTCVTSSGEKT--ATTVSIEKQIITEVTSIQEIFG-- 6339

  Fly  5903 EEITERQRKVKSIKKPKKVVTEKTVDQTEQPEKPEESQAEEVKETVTEEPKKPKPAPEEAKVEQV 5967
              :.:.:.|||           ...:::.||..|.|:..|.....:.|...|.:....|..::.:
 Frog  6340 --LAQERSKVK-----------LEDEESSQPSLPPEAAQEGDLHLLWEALAKKRRMSREPTLDSI 6391

  Fly  5968 EKISLKPAPRKQRLLPEKEQVEEVLLKPVKKIVAVSEAEQPETPETEFEVKEFAITTTED----- 6027
            .::..:...|:|:  .|.::..:........:...|||             :|::|:::|     
 Frog  6392 SEVPEEEEKRRQK--KEADRRSDFSGYTSDDLTKTSEA-------------DFSVTSSDDESRAG 6441

  Fly  6028 ---ILDVTKKRVKKKKPKTKVAAEESTEEPAEETEEFEE-EATQPEEVQPVEEIPEEPQVKEVAD 6088
               ::...|| ....|....|....|..:...|::.|:. |..:||..:|..  |:||:|.::..
 Frog  6442 TPSLVSYLKK-AGHSKAGHSVITHGSKVQTMSESKFFKHFEIIEPERKEPPP--PQEPEVPDLFQ 6503

  Fly  6089 ERKTAPKPKPRKEEIIEKVEEVALK----RVTRPKKELPQEA-TIEEVRLKPTQRTSIKPEEVKL 6148
            :      ..|..::...|: :.|.|    |....::|.|..| |.::..::|  ..::..|.|.:
 Frog  6504 D------DDPALDKAAVKI-QAAFKGYKARKVIKQQECPLLAETFKDFTVEP--GGTVHLECVAI 6559

  Fly  6149 EEVDLQHVEKKEDEIVQEEKRKTRKVKKPKHEDLPEIPDAEPTQLEEAEHIELEKQPKPEEDQPQ 6213
            .:.|:.....|:|          :::...:|..:....|...:.:..|  :|.....|...:...
 Frog  6560 SKTDITTRWLKDD----------KELSDGRHYHIDNYTDGTCSLIITA--VETADTGKYTCEASN 6612

  Fly  6214 VPWKRGEKKQPVEEVLEEKKWPSGKRRPLPEQQPEEVQLKPIPSKPIEEQQKPEKAIPGPQLVPE 6278
               |.|........|:     .||    ||:          :|.||     ||..|..|      
 Frog  6613 ---KFGAVSHSASLVV-----GSG----LPQ----------VPEKP-----KPSIAKLG------ 6644

  Fly  6279 EKPESEEEELELEPLKLPEDKKPKEPKAKKEKKKKPKLKKATPSVDEVSEEVAEPFDEPIAEEDE 6343
              .:||.|......|         :...:|..::..|:.|:..|:     |:::..:|.....||
 Frog  6645 --SDSETESTSGSDL---------DDAFRKAGRRLHKIFKSKTSL-----EMSDVEEELFVSADE 6693

  Fly  6344 VEEMPVD------DVKVVAVSEDVLPEEEVVPTEETPEAKQKAHKKRTKRLKEA-SVEGQP---Q 6398
            .:..|||      |.|.:.:..:::.|..:.                .||.||. |..|.|   .
 Frog  6694 GDLPPVDQQTYREDDKYIYIKFEIMSEASIA----------------AKRFKEMFSAMGIPVKID 6742

  Fly  6399 LLEAAIAEIE----KVD----EISQEISQKTITLLKKTEDTRPQFITTEQLIELDVEDVRRDLEM 6455
            :|:..:..||    ||:    |..:..::..||||  |.||.|.|||     ||..::|:....:
 Frog  6743 ILDQGLKNIELRIMKVETGTTEQQRMAARHQITLL--TSDTAPIFIT-----ELQNQEVKDGYPV 6800

  Fly  6456 KVTSNIIKKEKRRVVLDDSQPLPELELITQKRIQEGIDKVADEE----LIEDQQ----------- 6505
            .....:|.|           |:|     |.:..::|  ||.:|:    :.|||:           
 Frog  6801 SFDCVVIGK-----------PMP-----TVRWFKDG--KVIEEDDHYMINEDQEGCHQLIITAVV 6847

  Fly  6506 ---------LIQNQ----------------------QETTTSE------VIGQERKLVKKKKKEI 6533
                     |.:|:                      :.|.||.      .:.:|::.::...::.
 Frog  6848 PKDMGVYRCLAENRMGVSSTKAELRVDLTSSDYDTAEATETSSYFSAQGYLSREQEGLESATEQD 6912

  Fly  6534 KPPRITEKLRPRQCVPEEPTV-LECKVEGVPFPEIKWYFNDILLFASEKYEITVMEQVAKLKIAK 6597
            :.|::.|:||.....|..|.. .|.||:|.|.|.:.|:.:...:.||::..||..:::..|:|..
 Frog  6913 QLPQVLEELRDTMVAPGTPLAKFEIKVKGYPRPRVYWFKDGQPIHASDRILITDRKKLHALEILN 6977

  Fly  6598 VTPSDVGVYTCEAKNEAGVATSRTNII------LEK----------EQGVPPQFTKPLKIEFIEE 6646
            ||..|.|.|:....|.||.|.|...:.      |:|          |:.|||:|.:    .|..:
 Frog  6978 VTKEDSGEYSTYISNSAGSAYSSARLSVKGPDELQKDKPLEDAGDGEKPVPPRFLE----RFTNK 7038

  Fly  6647 KQPERLKVTVTCQVTGKPNPEVKWYRGIEEVIPSETVQMFYDEKTG---------------DVAL 6696
            |..:...:|::.:|.|.|.|.:.|   ::|..| |.|.....|..|               ||..
 Frog  7039 KVLKGASITLSVKVEGTPPPTITW---LKEDSP-EDVLWIKPETPGYKLASSNRHHSLILLDVGT 7099

  Fly  6697 EVINPTPNEAVVYSVQAQNQFGRAI----------GNANILSRVDEVPREILKAPTVTPLSAV-- 6749
            |.       :..|:..|.|:.|::|          ..|.||...|::.:|:|..   ||||..  
 Frog  7100 EF-------SGTYTCIATNKVGQSICTASVEIAEAKEAKILKEADKLVKEMLGR---TPLSGFEE 7154

  Fly  6750 ----------------------------VVPTGGTLFFE-----------AKYD----------- 6764
                                        :...|...||:           ||..           
 Frog  7155 GREAEPGVIGISVQPPEDSGEVPKPHISLTDVGTEEFFQKLTSHITEMVSAKISQATLRVPGTTG 7219

  Fly  6765 ----------------GLPRPEVKWMRNGRE----------------------IIENEETI---- 6787
                            |..||....:.:..|                      |:.::|:|    
 Frog  7220 MDSDEETKTPSASPRHGRSRPSSIAVESSSESEDGDSRGEIFDIYMASADYNPIVADKESITLKE 7284

  Fly  6788 ---IETTETTTTIKVVNMTR------------------KRTGKYEVWAKNKVGEAKSSGSVVVSD 6831
               :|..::...:|.:..|:                  ||......||   :|||.....|.||:
 Frog  7285 GQYVEVLDSAHPLKWLVRTKPTKFSASRQGWVSPAYLDKRLKLSPEWA---LGEAPEVSGVCVSE 7346

  Fly  6832 QK---------------PDEQIKPPRFIQ----------PLEPKYFGEHEVAIIEAI-------- 6863
            .:               ..|.:|..:|::          |..|:.....:..|...|        
 Frog  7347 DEYKKKLSILLQDLLNTEKEYVKELQFLENHHLHHTENSPDIPENVASQKSTIFRNISDIGNFHS 7411

  Fly  6864 ---------------------------------------VESEPLS-SFQWFVHN---------- 6878
                                                   .||..|| |.|.|..|          
 Frog  7412 NIFFPELKKCDTDDDIAMSFIKNEDEFNKYIMFLVGRVQAESVVLSDSIQEFYKNYSDERLALSD 7476

  Fly  6879 --------------EPIKSSNEVRIV--------SQANKSTLLIENFQSKFVGPFTCRAENVGGS 6921
                          .||......:::        ::..|:..|:|...: .|...|.||||.   
 Frog  7477 PSKPPVPPLQHYLERPINRIQRYQVIIKELIRNKARNGKNCALLEQAYA-IVSALTRRAENF--- 7537

  Fly  6922 VTSTATVNLIPQEEAEEFESPRFVEELVQPVEVMDGEALLLTCQVTGKPTPKVEWYHNAEKITEN 6986
                ..|:||     |.:  |..:|.|.:|:.  .|..::.    .|.|..::.|..:      |
 Frog  7538 ----LHVSLI-----ENY--PGTLEALGEPIR--QGHFIVW----EGAPGARMAWKGH------N 7579

  Fly  6987 KETTISQDLQGVCQLQITEVFPENEGQ---YECVATNKIGKSVSKTNVKI--------QAFE--- 7037
            :...:.::...:|:       |:.:.:   |..|..|    .:..||:.|        :|||   
 Frog  7580 RHVFLFKNYLIICK-------PKRDTRTDTYSYVFKN----MMKLTNIDINDQIEGDDRAFEVWH 7633

  Fly  7038 ----------------YIPDSEITGLTGSEEDLLDRTLSIDEQAPKIIKKLPEKIEPKEGEQAKL 7086
                            .|.:|.:..:.|.:|..   ::.| ...||.|:.|.: ...:.||..||
 Frog  7634 EREDSVRKYLLQARTVIIKNSWVKEICGIQERF---SMPI-WNPPKFIEVLAD-CTAELGETVKL 7693

  Fly  7087 EVKVVGKPKPKVKWLRDDEQIFASEEYQIENFEDGTSVLVINHVYPDDLGTISFEAYNPLGVAVT 7151
            ..:|.|.|||.|.|.:|...:.|...:.|....||:..|:::::...|.|.....|.:|.|.|.|
 Frog  7694 ACRVTGTPKPVVAWYKDGRPVEADPHHIIIEDPDGSCTLILDNMTGADSGQYMCFAASPAGSAST 7758

  Fly  7152 TALFAVEVKFFFRCLELHYLCFPNSLESSIVGSKDYRKPEWVSQMEEMQVALKAAKCSPSLLNEM 7216
            .....|:|                                                 .|..:|::
 Frog  7759 LGKILVQV-------------------------------------------------PPRFVNKL 7774

  Fly  7217 RDCRAALGETAKFSIQFAGNPIPDIQWYFNNVQLRASEKYRMVVQEQEA--TLEIMKITSEDCGY 7279
            |:.....||.|:|:....|.|.|.|:||.....|..|.||:...:.:..  .|.|...|:||.||
 Frog  7775 RNAHFVDGEDAQFTCTIDGAPYPQIRWYREGKLLSESAKYQTFTEPRSGVLVLVIKNATNEDLGY 7839

  Fly  7280 YNCKLINEIGMTMTRAKFDISSTSTIVEETKAKTTVKKKSGKKTMVKRSGASESQNVQKT--EIR 7342
            |.|:|.|.:|...:.|:....:.:.:.:|.:...|:        .::..|.|...::::.  |||
 Frog  7840 YECELGNRLGSARSGAELSPMTPALLAQERRGDQTI--------TIEGVGGSIRASLERADQEIR 7896

  Fly  7343 IIPTSAVETSMNVIKVKQPVSV--LVEKSEISEVLVVKDREVADA-EERSSQLIEEIEEEEEIEE 7404
            .:....|||....:...|.||.  |..|...:....|::|:..|. .:.::|..|:..||::   
 Frog  7897 QVLQKLVETPGTGLMPPQLVSPKGLGTKKSAAVQSSVEERKAMDMFRDANTQTPEDQGEEKK--- 7958

  Fly  7405 KVQHDEEDEVEVQVEQKETY------TSSKKIEITKTVEL------------------------I 7439
                        |:|||||.      |:|:|.|.....||                        :
 Frog  7959 ------------QMEQKETTETHEIPTASQKQEAPGVPELHIPIRLGMEASDWYLRRAPAHIWDV 8011

  Fly  7440 RTKISEKIITIEDVQVLSHHEE---------VQWLLESIEAESFGQIGESALRDL---ATIGLLL 7492
            |::     :.||..:....|.:         :|..:|.:..    |.|::|..|.   .|..|.:
 Frog  8012 RSQ-----VYIESTETTCVHFKDDKATRPPYMQVTIEDVHT----QCGDAARFDAVIEGTAPLTI 8067

  Fly  7493 RYGCEHYEITYMYEQNIFISLKKPESQSALVQLVEREGHEELISQILSESSNEDETI-------L 7550
            .:          |:.|:      |.::...:|:|:   .:...|.||.::..:|..|       :
 Frog  8068 AW----------YKNNV------PLTECERIQIVK---EDRKYSLILRDTKPDDGAIYTCVARNM 8113

  Fly  7551 AATVGFKAFIRMIQTYEITIEIVIRKFVREDFISQDWKICGKERIVETSQIIESHEAITHVKIEE 7615
            ...|..||            |:|    :.||         .||.:.||.|.....::...|| ||
 Frog  8114 GGEVSCKA------------ELV----MHED---------TKEHVTETVQKRRKLKSFFEVK-EE 8152

  Fly  7616 T------FVEERTIIVQEETATTKVEKLFKKQEQEHVQNLEQQEQVKIQVQTKQIAQMNTKIKKH 7674
            .      ||:.   :|.:........|.                 :.::.:|:|           
 Frog  8153 IGRGCFGFVKR---VVHKGNGANCAAKF-----------------IPLRSKTRQ----------- 8186

  Fly  7675 KKHKQQE--QEVSETTIQC-----EQKETL--------AHETSAELPQSETLEQIEESLSTYETL 7724
            :.::::|  .|:|.:.|.|     |.::||        ..|....|.:...:.  |..:..|...
 Frog  8187 RAYRERELLSEISHSNITCLLDAFETRKTLILIMDICCGEELLDRLFKKSIVS--EREVKVYIRQ 8249

  Fly  7725 PIQNL----SKDTLQTVAVSVTTELSTPSPTASRVQEEILPQKVLAIN--EEVLPLDEFGL---- 7779
            .::.:    .||.|..                     ::.|..:|.:|  ::.:.|.:||.    
 Frog  8250 LVEAIGYLHDKDILHL---------------------DVKPANILMVNTDQDDIKLCDFGFAQKR 8293

  Fly  7780 RKESPRPKENKLTENIEVRLKHALNVSHAKTAESSKELPSKIPKSVKAQRKMKESRSLVVEAPNA 7844
            |:..|:..:....|.:...:...|.||     |:|...|..:...:          .||..:|.|
 Frog  8294 RRSEPQYSKYGSPEFVSPEIASQLPVS-----EASDIWPIGVITYL----------CLVCASPFA 8343

  Fly  7845 EEAIEDLKPLKAVSQEVQSDILFSHEITEEQHQALETIEKLKPTSAIEDTVQQKLLSQEELIIAE 7909
            .:  .|.:.|.:|.|         .:|:......:|..|:.|  ..|..|:|             
 Frog  8344 GQ--NDRETLLSVQQ---------GKISWHNQGFIELSEEAK--DFIRRTIQ------------- 8382

  Fly  7910 VLPSETVGRDVTDVRPPGETISPRLTPNMSLCITECQPEDSIGEMQQAAKERMETPSMSVTESKA 7974
                                :||...|:...|......:...||.                    
 Frog  8383 --------------------MSPESRPSAVECSNHKWFQGCSGEK-------------------- 8407

  Fly  7975 VGGQELEVLENVDHMPLITQPTKGLADYT------------IKAEEVPVQVQEIITFDSL--ERE 8025
                        |..|:||:..|.|...:            :....:|..:|..:...||  .|.
 Frog  8408 ------------DTRPIITKGLKFLVARSRWQRSLMCYRSILVMRSIPELLQGNVERTSLGVPRH 8460

  Fly  8026 TVAKTQTAKSNALELFELSEGLVSSTADSHSPIAE-DLPIFEKDVKEATIDMQMQHHVTTSETVS 8089
            .|..:.::.|:...  ..:|..:|.||...:|..| .|.||:...::...::..:..:.|.|...
 Frog  8461 LVEGSSSSSSSGSS--SDNESDISPTARGSNPSLELHLSIFKMYDRDTFQEVSQKADIITQEEKR 8523

  Fly  8090 NENAVKDLKAVDTPKMAEGTLGQSSALTIGETQQMNLVETTVELIEPNVESTKPAKGALTEAYGT 8154
            ::               |.||..|......||.::|..|.||.|                     
 Frog  8524 SQ---------------EATLVCSDKSGAQETDKVNFAEDTVNL--------------------- 8552

  Fly  8155 AESNEETLLESLGLVPDDNRKIEQGKVNISEGEYVAKVQTTTVTDTEGEFVSVAPKLVNPKFDFV 8219
             |..::.|:||               |..|.|                            |..|.
 Frog  8553 -EQTDKMLVES---------------VETSPG----------------------------KRPFC 8573

  Fly  8220 EQSALQIKQDTTVEKEEILSSNIELAPQLATSNMFPAELKVTSIYEVQPGLTSSDIITEQTKSVS 8284
            :.:.:::.               :||.:...|..|   ::.:|......|:....::....:|: 
 Frog  8574 KAATIEVG---------------DLASKKGKSGCF---VRGSSADSALLGVDRHTLVCVPRQSI- 8619

  Fly  8285 ANQVFETMS---IGVTSKPDMLESTSHIDAFQHPEFKTGDTILDENQQPLEVTNVQITESSTDII 8346
            .|..|.:.|   .|:|.:...|.....|   :|.|                              
 Frog  8620 INSTFYSQSGEGAGLTPRDGALREKEFI---KHRE------------------------------ 8651

  Fly  8347 DVLPNQKLTKAETVTDGF--KYAEGLVVLPMESTIDKTEDTKPTAVNADISMHQQFGTDVREQEP 8409
              ...:.|.||     |:  |...||                                    :||
 Frog  8652 --KARRSLMKA-----GYSQKILSGL------------------------------------REP 8673

  Fly  8410 LESTLTRTEDLKPQTQTTESQFGLLQSLETSSCVTLEGESVLSVKERHPEQSAAIGTSSALQVAN 8474
            |.......:.:..|.:...:|.|...||:.|  |:.:|      .:..|..|....:.|      
 Frog  8674 LLEQFAMEQRIIAQDKAQATQEGPSGSLKKS--VSFDG------SKGSPRSSFKASSRS------ 8724

  Fly  8475 ITRPQHMESLDRLDEQKVPYYQANVNIGEITLPNVEKIDSFDVLSDLNTPDYNKSSKGRVQLIES 8539
                   .|||....:.:..|:     |.:.....:|:...|.:...||..:::.          
 Frog  8725 -------RSLDDCKSRPLTVYK-----GVLLEEGGQKVSVGDKILHTNTQCHSEE---------- 8767

  Fly  8540 TTSLKTTTAVVSESTEELKDLNITQPVHIKPKP--------YESDQKISISEQTNVLEHVSSLNP 8596
                   ||..|:.|:     .||..:|.:.:|        :::...||.:::......|.|.|.
 Frog  8768 -------TATQSDFTQ-----GITDSIHSRVQPEVPHAAKEHQAPLFISSTQRPLSATTVDSENT 8820

  Fly  8597 VLPALETIQSSIKSLHEINVRETDI-LEKEESLKDVDHISGRLAKIILDCTTGIAQVRQEETLEH 8660
            ::..|.  |..|.....:..|...: ||.|||                   |.||.::|:..|..
 Frog  8821 IIAVLH--QQPIFDSGSVKERPPSLALEVEES-------------------TVIAFLQQKPLLFA 8864

  Fly  8661 E--------EDLKAPLIPLEKAIPASSE------------------------LHRLPLTEYVQEQ 8693
            |        |.:|..:.|.|..:|:..|                        ..:.|:.:|   |
 Frog  8865 EPSKTHVDTEGIKDSIQPQETGLPSQFEGPTPHLGGSVTFTVKTTSDTNYFLASQPPVEKY---Q 8926

  Fly  8694 QGTSDMTDFKVSNK-CASPNIDHLYETKSSEMIVYDSSINSVDSEFPAGIVPQKSLVPFRHTMVT 8757
            .|:...|:..|:.: ..||:     .|..|...|    :...||:....|:||.           
 Frog  8927 VGSEVGTETSVNQESTVSPD-----STMESTPYV----VQFTDSKSSTAIIPQG----------- 8971

  Fly  8758 ENVAFNASENFEILSADQQIATNVQDSLSQSIIAEDQIAFETEQNLGLETTPTHKPKLLKDDQNL 8822
                         |..|..:....::....::.....:..:.|:...:....|..|      :||
 Frog  8972 -------------LQKDPPLLKATKERAVVTVTEATAVTEKVEEKCSITNLDTFSP------ENL 9017

  Fly  8823 HAKLV-DEATVYEAMGQEQKVDKYNIQQAEITHDLPQVYATDLQQTFEAE-KEITTREQSYVAAT 8885
            |.... .:..:..::.:.|::...:.:..||..|:.:      |.|.|.. ..:.:.|||  ||.
 Frog  9018 HLSTQHGDVILKPSISEHQELGSTSERHCEIIKDVSR------QNTDENRGSSLYSDEQS--AAL 9074

  Fly  8886 TDIIPSRLGLAMTTKTHPVEGIDVLLSSPPKPSLAQTNYEETQHEVRVRETQAIEESEELTDGRL 8950
            .|::..        .|:..|.::||..:..:.|    |.:.|:.:.:|..            |.|
 Frog  9075 EDLVGE--------MTYLSEQMNVLAGNQEQIS----NIKSTEGKTQVER------------GPL 9115

  Fly  8951 LPVSAVESIDSTFKVTSDSQQPPVFDKELSIPTVSPLEARAKPSLNLLQGTTTFD-VIPLESSVL 9014
            .|..|:|:                  :.|.:.|.:..:|..:|.|..:...:.:| :.|.::|.|
 Frog  9116 DPGLAMET------------------EVLIVQTSASPQASKEPQLTSVSQCSFYDSLCPAQASPL 9162

  Fly  9015 LKDTHVAVQ--KAQQEYVAQVESNKVHVQMDNLVMHKEDIFENAEIENFCKPITEGTQLETVVIE 9077
            |.:...:::  .:.:.:::..:|::...:.||.     ..||.|           |...|..::|
 Frog  9163 LHEEEFSIESRSSSKTFISHSDSSETGRRSDNF-----SDFEEA-----------GRHSEVSLLE 9211

  Fly  9078 VVPID-------NVGGIHLAPQPSTLLATLTSTDIVNQSHVIDTQVPLEMESEAQAPLDNIAQAR 9135
            :..::       :||..|..|               .|||::|      .....::|.:::..::
 Frog  9212 IEELNYNSPSTSSVGPFHFEP---------------TQSHLLD------FYGIKESPRNSVDPSQ 9255

  Fly  9136 IKSAEDHVHTNVS---------EVNVYEQTKAIQDQNKHGLFVKVSKNSDTSKAYLTTIQSTFLK 9191
            .|...|:...|::         :..:.|:|           ..||||..:..:..    .|:..|
 Frog  9256 EKPLSDNEKLNLNSQPLLGGKHDTKIDERT-----------MEKVSKKEEIKERK----SSSSRK 9305

  Fly  9192 EDILPKPNILQDTAQAAADE-LQSLVTEEVVSVSSI--------QE-----------------TY 9230
            ...|.:|:...|::..::|: |:..|...|.::|.|        ||                 |.
 Frog  9306 RIKLFRPHSKTDSSGKSSDQSLKQKVKASVANISRIIKGKPSNGQERKEGIEGPKADSLVQAATE 9370

  Fly  9231 ELKIPLQKTA-NLTQQTPQNSVN-VCQQLAYEETPDIAFEPHALTRATTSSVPTFLKPAENATVN 9293
            .:.:.::|.: .||..:|::..| |......|.|.......|.:|.:..:|.|.           
 Frog  9371 RIAVHMKKKSFKLTSLSPKDKGNSVAPAFVEELTDQTVVVGHLVTLSCRTSEPV----------- 9424

  Fly  9294 IYENIEGHGDFKP--GTVNLTSNSNLNS----ELVVSVVQEV-----TSVPSLGSLATVEPQELK 9347
              ..:|...|..|  |...:..:|.|.:    .::|.:.|::     .:..||||.:|....:..
 Frog  9425 --TEVEWFKDGVPIQGNERVLISSTLKNYHLLTILVVMAQDLGIYACVASNSLGSASTCCILKRA 9487

  Fly  9348 AMPVTKSSTNLAYSEEGGIPYVQITVEEAK----LVNTRADVEENITSVTTEQPNMCIAASIQLP 9408
            .:|...:|..:|...:.|...|...||.|.    .|..|.:.|| ...:|.:..:.|.:..:   
 Frog  9488 EIPCCPTSPEVAQVYKDGALIVWKPVESASPVTYFVQYRKEGEE-WRPLTLDISDCCYSTHV--- 9548

  Fly  9409 AIEEKKLENALQTPQFASESILK------TSPQISRNAHFETRTHEEEYSTTTESLVT--TQALR 9465
             :.|.      |...|....|.|      ::|.........::|..:|..:|.|::..  |..|:
 Frog  9549 -LSEG------QVYSFRIACISKAGMGPYSNPSAGVRIGRPSQTFSKEMGSTEETVAADRTSTLQ 9606

  Fly  9466 DDIDSTQKNVMQDVQMYKH------FATKSLDKTVKVETDTNQ------ATDTTHIKQKTPTHKL 9518
            ..:   .:.....|:..|.      ||.|.:..|.|.:..|.|      ....::|.|.......
 Frog  9607 TGV---TRGRFSSVRPCKEKSSGRLFAAKIIPYTDKSKESTLQEYLILKQLHHSNIVQLHGAFLS 9668

  Fly  9519 ASSTTQITESPEIIKTIETISEDGSPSKKMIRTRLIKKVKGNKQEFTKIETVEEDDKQPETTVTV 9583
            ......|.|..|.::.::.:|...|.|:..:|..|.:.:  :..||...:.:...|.:.|.|:..
 Frog  9669 PHDLVLILELCEGLELLQFLSLGPSYSELEVRDYLWQML--SAVEFLHAKQILHLDLRSENTIVT 9731

  Fly  9584 E 9584
            |
 Frog  9732 E 9732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slsNP_001261304.1 I-set 87..174 CDD:400151 24/92 (26%)
Ig strand B 104..108 CDD:409353 1/3 (33%)
Ig strand C 117..121 CDD:409353 1/3 (33%)
Ig strand E 144..148 CDD:409353 1/3 (33%)
Ig strand F 158..163 CDD:409353 3/4 (75%)
I-set 255..344 CDD:400151 16/91 (18%)
Ig strand B 272..276 CDD:409353 1/3 (33%)
Ig strand C 285..289 CDD:409353 0/3 (0%)
Ig strand E 310..314 CDD:409353 1/3 (33%)
Ig strand F 324..329 CDD:409353 1/4 (25%)
Ig strand G 337..340 CDD:409353 0/2 (0%)
IgI_Myotilin_C_like 372..462 CDD:409405 23/90 (26%)
Ig strand A 372..375 CDD:409405 0/2 (0%)
Ig strand A' 378..383 CDD:409405 0/4 (0%)
Ig strand B 388..395 CDD:409405 1/6 (17%)
Ig strand C 402..408 CDD:409405 3/5 (60%)
Ig strand C' 409..412 CDD:409405 1/2 (50%)
Ig strand D 418..424 CDD:409405 2/5 (40%)
Ig strand E 427..437 CDD:409405 3/9 (33%)
Ig strand F 441..449 CDD:409405 3/7 (43%)
Ig strand G 451..462 CDD:409405 3/10 (30%)
I-set 471..560 CDD:400151 25/116 (22%)
Ig strand B 488..492 CDD:409353 1/3 (33%)
Ig strand C 501..505 CDD:409353 0/3 (0%)
Ig strand E 527..530 CDD:409353 1/2 (50%)
Ig strand F 540..545 CDD:409353 2/4 (50%)
Ig strand G 553..556 CDD:409353 0/2 (0%)
Ig 618..709 CDD:472250 24/113 (21%)
Ig strand B 635..639 CDD:409564 0/3 (0%)
Ig strand C 650..654 CDD:409564 1/3 (33%)
Ig strand E 675..679 CDD:409564 0/3 (0%)
Ig strand F 689..694 CDD:409564 2/4 (50%)
Ig strand G 702..705 CDD:409564 1/2 (50%)
Ig 751..835 CDD:472250 26/114 (23%)
Ig strand B 769..775 CDD:409353 2/24 (8%)
Ig strand C 784..788 CDD:409353 1/3 (33%)
Ig strand E 810..816 CDD:409353 1/5 (20%)
Ig strand F 823..828 CDD:409353 1/4 (25%)
Ig strand G 836..839 CDD:409353 2/16 (13%)
Ig 890..982 CDD:472250 23/91 (25%)
Ig strand B 908..912 CDD:409353 0/3 (0%)
Ig strand C 923..927 CDD:409353 1/3 (33%)
Ig strand E 948..952 CDD:409353 1/3 (33%)
Ig strand F 962..967 CDD:409353 2/4 (50%)
Ig strand G 975..978 CDD:409353 0/2 (0%)
Ig 1024..1116 CDD:472250 18/91 (20%)
Ig strand B 1042..1046 CDD:409353 0/3 (0%)
Ig strand C 1053..1061 CDD:409353 0/7 (0%)
Ig strand E 1082..1086 CDD:409353 1/3 (33%)
Ig strand F 1096..1101 CDD:409353 1/4 (25%)
Ig strand G 1109..1112 CDD:409353 1/2 (50%)
Ig 1158..1250 CDD:472250 15/105 (14%)
Ig strand B 1176..1180 CDD:409353 0/3 (0%)
Ig strand C 1191..1195 CDD:409353 1/3 (33%)
Ig strand E 1216..1220 CDD:409353 1/3 (33%)
Ig strand F 1230..1235 CDD:409353 2/4 (50%)
Ig strand G 1243..1246 CDD:409353 0/2 (0%)
Ig 1291..1380 CDD:472250 28/91 (31%)
Ig strand B 1308..1312 CDD:409564 1/3 (33%)
Ig strand C 1323..1327 CDD:409564 0/3 (0%)
Ig strand E 1348..1352 CDD:409564 1/3 (33%)
Ig strand F 1362..1367 CDD:409564 2/4 (50%)
Ig strand G 1375..1378 CDD:409564 1/2 (50%)
Ig 1424..1515 CDD:472250 21/99 (21%)
Ig strand B 1442..1446 CDD:409353 1/3 (33%)
Ig strand C 1457..1461 CDD:409353 1/3 (33%)
Ig strand E 1482..1486 CDD:409353 1/3 (33%)
Ig strand F 1496..1501 CDD:409353 2/4 (50%)
I-set 1558..1645 CDD:400151 26/87 (30%)
Ig strand B 1575..1579 CDD:409353 1/3 (33%)
Ig strand C 1590..1594 CDD:409353 1/3 (33%)
Ig strand E 1615..1619 CDD:409353 0/3 (0%)
Ig strand F 1629..1634 CDD:409353 3/4 (75%)
Ig strand G 1643..1646 CDD:409353 2/2 (100%)
I-set 1691..1782 CDD:400151 15/90 (17%)
Ig strand B 1708..1712 CDD:409353 1/3 (33%)
Ig strand C 1721..1727 CDD:409353 0/5 (0%)
Ig strand E 1748..1752 CDD:409353 1/3 (33%)
Ig strand F 1762..1767 CDD:409353 0/4 (0%)
Ig strand G 1775..1778 CDD:409353 0/2 (0%)
I-set 1824..1916 CDD:400151 20/94 (21%)
Ig strand B 1842..1846 CDD:409353 1/3 (33%)
Ig strand C 1857..1861 CDD:409353 1/3 (33%)
Ig strand E 1882..1886 CDD:409353 1/3 (33%)
Ig strand F 1896..1901 CDD:409353 3/4 (75%)
Ig strand G 1909..1912 CDD:409353 1/2 (50%)
Ig 1958..2049 CDD:472250 28/91 (31%)
Ig strand B 1975..1979 CDD:409564 2/3 (67%)
Ig strand C 1990..1994 CDD:409564 2/3 (67%)
Ig strand E 2015..2019 CDD:409564 1/3 (33%)
Ig strand F 2029..2034 CDD:409564 3/4 (75%)
Ig strand G 2042..2045 CDD:409564 1/2 (50%)
Ig 2089..2181 CDD:472250 24/107 (22%)
Ig strand B 2107..2111 CDD:409353 1/3 (33%)
Ig strand C 2122..2126 CDD:409353 1/3 (33%)
Ig strand E 2144..2151 CDD:409353 2/6 (33%)
Ig strand F 2161..2166 CDD:409353 2/4 (50%)
Ig strand G 2174..2177 CDD:409353 0/2 (0%)
Ig 2222..2314 CDD:472250 24/93 (26%)
Ig strand B 2240..2244 CDD:409353 1/3 (33%)
Ig strand C 2253..2259 CDD:409353 0/5 (0%)
Ig strand E 2280..2284 CDD:409353 1/3 (33%)
Ig strand F 2294..2299 CDD:409353 1/6 (17%)
Ig strand G 2307..2310 CDD:409353 1/2 (50%)
Ig 2356..2448 CDD:472250 17/102 (17%)
Ig strand C 2389..2393 CDD:409353 1/3 (33%)
Ig strand E 2414..2418 CDD:409353 0/3 (0%)
Ig strand F 2428..2433 CDD:409353 2/4 (50%)
Ig 2516..2577 CDD:409353 11/60 (18%)
Ig strand C 2521..2525 CDD:409353 2/3 (67%)
Ig strand E 2546..2550 CDD:409353 1/3 (33%)
Ig strand F 2560..2565 CDD:409353 2/4 (50%)
Ig strand G 2574..2577 CDD:409353 0/2 (0%)
I-set 2622..2714 CDD:400151 21/93 (23%)
Ig strand C 2655..2659 CDD:409353 0/3 (0%)
Ig strand E 2680..2684 CDD:409353 2/3 (67%)
Ig strand F 2694..2699 CDD:409353 1/4 (25%)
I-set 2754..2844 CDD:400151 28/92 (30%)
Ig strand B 2771..2775 CDD:409353 1/3 (33%)
Ig strand C 2786..2790 CDD:409353 1/3 (33%)
Ig strand E 2811..2815 CDD:409353 2/5 (40%)
Ig strand F 2825..2830 CDD:409353 2/4 (50%)
Ig strand G 2838..2841 CDD:409353 0/2 (0%)
Ig 2905..2981 CDD:472250 15/75 (20%)
Ig strand C 2925..2929 CDD:409353 1/3 (33%)
Ig strand E 2950..2954 CDD:409353 1/3 (33%)
Ig strand F 2964..2969 CDD:409353 2/4 (50%)
Ig strand G 2978..2981 CDD:409353 1/2 (50%)
Ig 3029..3120 CDD:472250 23/91 (25%)
Ig strand C 3062..3066 CDD:409353 0/3 (0%)
Ig strand E 3087..3091 CDD:409353 3/4 (75%)
Ig strand F 3101..3106 CDD:409353 3/4 (75%)
Ig 3130..3220 CDD:472250 21/89 (24%)
Ig strand B 3148..3152 CDD:409353 0/3 (0%)
Ig strand C 3163..3167 CDD:409353 1/3 (33%)
Ig strand E 3188..3192 CDD:409353 2/3 (67%)
Ig strand F 3202..3207 CDD:409353 2/4 (50%)
Ig strand G 3216..3219 CDD:409353 1/2 (50%)
Ig 3263..3354 CDD:472250 25/90 (28%)
Ig strand C 3296..3300 CDD:409353 2/3 (67%)
Ig strand E 3321..3325 CDD:409353 1/3 (33%)
Ig strand F 3335..3340 CDD:409353 1/4 (25%)
I-set 3401..3493 CDD:400151 28/92 (30%)
Ig strand C 3434..3438 CDD:409353 2/3 (67%)
Ig strand E 3459..3463 CDD:409353 1/3 (33%)
Ig strand F 3473..3478 CDD:409353 3/4 (75%)
Ig strand G 3487..3490 CDD:409353 2/2 (100%)
I-set 3539..3630 CDD:400151 24/116 (21%)
Ig strand B 3556..3560 CDD:409353 1/3 (33%)
Ig strand C 3571..3575 CDD:409353 1/3 (33%)
Ig strand E 3596..3600 CDD:409353 1/3 (33%)
Ig strand F 3610..3615 CDD:409353 3/4 (75%)
Ig strand G 3623..3626 CDD:409353 1/2 (50%)
Ig 3676..3767 CDD:472250 25/91 (27%)
Ig strand B 3694..3698 CDD:409353 0/3 (0%)
Ig strand C 3709..3713 CDD:409353 1/3 (33%)
Ig strand E 3734..3738 CDD:409353 2/4 (50%)
Ig strand F 3748..3753 CDD:409353 4/4 (100%)
Ig strand G 3761..3764 CDD:409353 1/2 (50%)
I-set 3811..3900 CDD:400151 21/93 (23%)
Ig strand B 3828..3832 CDD:409353 0/3 (0%)
Ig strand C 3841..3847 CDD:409353 1/5 (20%)
Ig strand E 3868..3872 CDD:409353 1/3 (33%)
Ig strand F 3882..3887 CDD:409353 2/4 (50%)
Ig strand G 3896..3899 CDD:409353 1/2 (50%)
Ig 3954..4046 CDD:472250 17/91 (19%)
Ig strand B 3972..3976 CDD:409353 1/3 (33%)
Ig strand C 3987..3991 CDD:409353 1/3 (33%)
Ig strand E 4009..4013 CDD:409353 1/3 (33%)
Ig strand F 4026..4031 CDD:409353 2/4 (50%)
Ig strand G 4039..4042 CDD:409353 2/2 (100%)
Ig 4092..4180 CDD:472250 25/88 (28%)
Ig strand B 4109..4113 CDD:409353 2/3 (67%)
Ig strand C 4122..4126 CDD:409353 2/3 (67%)
Ig strand E 4146..4150 CDD:409353 1/4 (25%)
Ig strand F 4160..4165 CDD:409353 0/4 (0%)
Ig strand G 4173..4176 CDD:409353 0/2 (0%)
Ig 4394..4484 CDD:472250 23/89 (26%)
Ig strand B 4411..4415 CDD:409353 1/3 (33%)
Ig strand C 4424..4428 CDD:409353 1/3 (33%)
Ig strand E 4449..4453 CDD:409353 1/3 (33%)
Ig strand F 4463..4468 CDD:409353 3/4 (75%)
Ig strand G 4476..4479 CDD:409353 1/2 (50%)
I-set 4497..4581 CDD:400151 19/84 (23%)
Ig strand B 4514..4518 CDD:409564 0/3 (0%)
Ig strand C 4527..4531 CDD:409564 1/3 (33%)
Ig strand E 4552..4556 CDD:409564 1/3 (33%)
Ig strand F 4566..4571 CDD:409564 2/4 (50%)
I-set 4604..4693 CDD:400151 28/88 (32%)
Ig strand B 4621..4625 CDD:409564 1/3 (33%)
Ig strand C 4634..4638 CDD:409564 0/3 (0%)
Ig strand E 4659..4663 CDD:409564 1/3 (33%)
Ig strand F 4673..4678 CDD:409564 2/4 (50%)
Ig strand G 4686..4689 CDD:409564 2/2 (100%)
Ig 4702..4792 CDD:472250 21/89 (24%)
Ig strand B 4719..4723 CDD:409564 3/3 (100%)
Ig strand C 4733..4737 CDD:409564 2/3 (67%)
Ig strand E 4758..4762 CDD:409564 1/3 (33%)
Ig strand F 4772..4777 CDD:409564 2/4 (50%)
Ig strand G 4785..4788 CDD:409564 1/2 (50%)
rne <5284..5662 CDD:236766 59/405 (15%)
PTZ00121 <5931..6415 CDD:173412 97/515 (19%)
I-set 6536..6622 CDD:400151 29/86 (34%)
Ig strand B 6553..6557 CDD:409353 0/4 (0%)
Ig strand C 6566..6570 CDD:409353 0/3 (0%)
Ig strand E 6591..6595 CDD:409353 1/3 (33%)
Ig strand F 6605..6610 CDD:409353 1/4 (25%)
Ig strand G 6618..6621 CDD:409353 1/2 (50%)
Ig 6633..6727 CDD:472250 25/118 (21%)
Ig strand B 6650..6654 CDD:409353 0/3 (0%)
Ig strand C 6667..6671 CDD:409353 0/3 (0%)
Ig strand E 6694..6698 CDD:409353 1/3 (33%)
Ig strand F 6708..6713 CDD:409353 1/4 (25%)
Ig strand G 6721..6724 CDD:409353 1/12 (8%)
Ig 6741..6829 CDD:472250 27/202 (13%)
Ig strand B 6757..6761 CDD:409353 2/14 (14%)
Ig strand C 6770..6774 CDD:409353 0/3 (0%)
Ig strand F 6809..6814 CDD:409353 0/4 (0%)
Ig strand G 6822..6825 CDD:409353 0/2 (0%)
Ig 6841..6928 CDD:472250 24/176 (14%)
Ig strand B 6858..6862 CDD:409564 1/3 (33%)
Ig strand C 6871..6875 CDD:409564 2/3 (67%)
Ig strand E 6896..6900 CDD:409564 0/3 (0%)
Ig strand F 6910..6915 CDD:409564 1/4 (25%)
Ig strand G 6923..6926 CDD:409564 0/2 (0%)
I-set 6942..7033 CDD:400151 16/93 (17%)
Ig strand B 6960..6964 CDD:409353 0/3 (0%)
Ig strand C 6973..6977 CDD:409353 0/3 (0%)
Ig strand E 6999..7003 CDD:409353 1/3 (33%)
Ig strand F 7013..7018 CDD:409353 1/7 (14%)
Ig strand G 7026..7029 CDD:409353 0/2 (0%)
Ig 7066..7157 CDD:472250 28/90 (31%)
Ig strand B 7084..7088 CDD:409353 2/3 (67%)
Ig strand C 7097..7101 CDD:409353 1/3 (33%)
Ig strand E 7123..7127 CDD:409353 1/3 (33%)
Ig strand F 7137..7142 CDD:409353 0/4 (0%)
Ig strand G 7150..7153 CDD:409353 1/2 (50%)
Ig 7210..7289 CDD:472250 28/80 (35%)
Ig strand B 7227..7231 CDD:409353 2/3 (67%)
Ig strand C 7240..7244 CDD:409353 1/3 (33%)
Ig strand E 7265..7269 CDD:409353 1/5 (20%)
Ig strand F 7279..7284 CDD:409353 3/4 (75%)
Ig strand G 7292..7295 CDD:409353 0/2 (0%)
PTZ00121 <9687..10410 CDD:173412
PTZ00121 <10681..11475 CDD:173412
PTZ00121 <15007..15806 CDD:173412
rne <15728..15918 CDD:236766
SH3_p47phox_like 16753..16807 CDD:212790
I-set 16841..16931 CDD:400151
Ig strand B 16858..16862 CDD:409564
Ig strand C 16871..16875 CDD:409564
Ig strand E 16897..16901 CDD:409564
Ig strand F 16911..16916 CDD:409564
Ig strand G 16924..16927 CDD:409564
Ig_3 16964..17047 CDD:464046
I-set 17068..17152 CDD:400151
Ig strand B 17085..17089 CDD:409564
Ig strand C 17098..17102 CDD:409564
Ig strand E 17118..17122 CDD:409564
Ig strand F 17132..17137 CDD:409564
Ig strand G 17145..17148 CDD:409564
I-set 17176..17253 CDD:400151
Ig strand B 17180..17184 CDD:409564
Ig strand C 17193..17197 CDD:409564
Ig strand E 17218..17222 CDD:409564
Ig strand F 17233..17238 CDD:409564
Ig strand G 17246..17249 CDD:409564
Ig 17260..17342 CDD:472250
Ig strand B 17276..17280 CDD:409353
Ig strand C 17287..17291 CDD:409353
Ig strand E 17312..17316 CDD:409353
Ig strand F 17326..17331 CDD:409353
Ig 17347..17432 CDD:472250
Ig strand B 17364..17368 CDD:409353
Ig strand C 17376..17380 CDD:409353
Ig strand E 17402..17406 CDD:409353
Ig strand F 17416..17421 CDD:409353
Ig strand G 17425..17428 CDD:409353
Ig 17437..17521 CDD:472250
Ig strand B 17454..17458 CDD:409353
Ig strand C 17466..17470 CDD:409353
Ig strand E 17491..17495 CDD:409353
Ig strand F 17505..17510 CDD:409353
Ig strand G 17514..17517 CDD:409353
Ig 17538..17611 CDD:472250
Ig strand B 17544..17548 CDD:409353
Ig strand C 17556..17560 CDD:409353
Ig strand E 17581..17585 CDD:409353
Ig strand F 17595..17600 CDD:409353
Ig strand G 17604..17607 CDD:409353
Ig 17618..17708 CDD:472250
Ig strand B 17636..17640 CDD:409353
Ig strand C 17649..17653 CDD:409353
Ig strand E 17674..17678 CDD:409353
Ig strand F 17688..17693 CDD:409353
Ig strand G 17701..17704 CDD:409353
FN3 17712..17791 CDD:238020
Ig 17813..17898 CDD:472250
Ig strand B 17830..17834 CDD:409353
Ig strand C 17843..17847 CDD:409353
Ig strand E 17862..17869 CDD:409353
Ig strand F 17879..17884 CDD:409353
Ig 17917..17994 CDD:472250
Ig strand B 17922..17926 CDD:409353
Ig strand C 17935..17939 CDD:409353
Ig strand E 17960..17964 CDD:409353
Ig strand F 17974..17979 CDD:409353
Ig strand G 17987..17990 CDD:409353
FN3 17998..18090 CDD:238020
FN3 <18068..18364 CDD:442628
obscnXP_031759555.1 I-set 10..99 CDD:400151
Ig strand B 28..31 CDD:409353
Ig strand C 40..44 CDD:409353
Ig strand E 65..69 CDD:409353
Ig strand F 79..84 CDD:409353
Ig strand G 93..96 CDD:409353
I-set 112..204 CDD:400151
Ig strand B 129..133 CDD:409390
Ig strand C 142..146 CDD:409390
Ig strand E 170..174 CDD:409390
Ig strand F 184..189 CDD:409390
Ig strand G 197..200 CDD:409390
I-set 286..374 CDD:400151
Ig strand B 301..305 CDD:409405
Ig strand C 314..318 CDD:409405
Ig strand E 340..344 CDD:409405
Ig strand F 354..359 CDD:409405
Ig 381..464 CDD:472250
Ig strand B 396..400 CDD:409543
Ig strand C 404..412 CDD:409543
Ig strand E 433..437 CDD:409543
Ig strand F 447..452 CDD:409543
Ig 471..540 CDD:472250
Ig strand B 484..488 CDD:409559
Ig strand C 496..500 CDD:409559
Ig strand E 521..525 CDD:409559
Ig strand F 535..540 CDD:409559
Ig strand G 544..547 CDD:409559
FN3 <550..738 CDD:442628
FN3 560..647 CDD:238020
Ig 746..832 CDD:472250
Ig strand B 765..769 CDD:409559
Ig strand C 777..781 CDD:409559
Ig strand E 802..806 CDD:409559
Ig strand F 816..821 CDD:409559
Ig strand G 825..828 CDD:409559
Ig 843..924 CDD:472250 21/87 (24%)
Ig strand B 857..861 CDD:409559 1/3 (33%)
Ig strand C 869..873 CDD:409559 1/3 (33%)
Ig strand E 894..898 CDD:409559 1/3 (33%)
Ig strand F 908..913 CDD:409559 3/4 (75%)
Ig strand G 917..920 CDD:409559 1/2 (50%)
Ig 936..1016 CDD:472250 12/87 (14%)
Ig strand B 949..953 CDD:409559 0/3 (0%)
Ig strand C 961..965 CDD:409559 0/3 (0%)
Ig strand E 986..990 CDD:409559 1/3 (33%)
Ig strand F 1000..1005 CDD:409559 2/4 (50%)
Ig strand G 1009..1012 CDD:409559 0/2 (0%)
Ig 1028..1108 CDD:472250 15/88 (17%)
Ig strand B 1041..1045 CDD:409559 1/3 (33%)
Ig strand C 1053..1057 CDD:409559 0/3 (0%)
Ig strand E 1078..1082 CDD:409559 1/3 (33%)
Ig strand F 1092..1097 CDD:409559 2/12 (17%)
Ig strand G 1101..1104 CDD:409559 0/2 (0%)
Ig 1120..1200 CDD:472250 24/103 (23%)
Ig strand B 1133..1137 CDD:409559 0/3 (0%)
Ig strand C 1145..1149 CDD:409559 2/3 (67%)
Ig strand E 1170..1174 CDD:409559 1/3 (33%)
Ig strand F 1184..1189 CDD:409559 1/4 (25%)
Ig strand G 1193..1196 CDD:409559 1/2 (50%)
Ig 1211..1292 CDD:472250 22/85 (26%)
Ig strand B 1225..1229 CDD:409559 1/3 (33%)
Ig strand C 1237..1241 CDD:409559 0/3 (0%)
Ig strand E 1262..1266 CDD:409559 1/3 (33%)
Ig strand F 1276..1281 CDD:409559 2/4 (50%)
Ig strand G 1285..1288 CDD:409559 0/2 (0%)
Ig 1303..1384 CDD:472250 11/80 (14%)
Ig strand B 1317..1321 CDD:409559 2/3 (67%)
Ig strand C 1329..1333 CDD:409559 0/3 (0%)
Ig strand E 1354..1358 CDD:409559 0/3 (0%)
Ig strand F 1368..1373 CDD:409559 0/4 (0%)
Ig strand G 1377..1380 CDD:409559 1/2 (50%)
Ig 1396..1476 CDD:472250 19/95 (20%)
Ig strand B 1409..1413 CDD:409559 0/3 (0%)
Ig strand C 1421..1425 CDD:409559 1/3 (33%)
Ig strand E 1446..1450 CDD:409559 0/3 (0%)
Ig strand F 1460..1465 CDD:409559 2/4 (50%)
Ig strand G 1469..1472 CDD:409559 0/2 (0%)
Ig 1488..1566 CDD:472250 18/78 (23%)
Ig strand B 1501..1505 CDD:409559 0/3 (0%)
Ig strand C 1513..1517 CDD:409559 0/3 (0%)
Ig strand E 1538..1542 CDD:409559 0/3 (0%)
Ig strand F 1552..1557 CDD:409559 1/4 (25%)
Ig strand G 1561..1564 CDD:409559 0/2 (0%)
Ig 1579..1658 CDD:472250 23/81 (28%)
Ig strand B 1593..1597 CDD:409559 0/3 (0%)
Ig strand C 1605..1609 CDD:409559 1/3 (33%)
Ig strand E 1630..1634 CDD:409559 1/3 (33%)
Ig strand F 1644..1649 CDD:409559 1/4 (25%)
Ig strand G 1653..1656 CDD:409559 1/2 (50%)
Ig 1671..1750 CDD:472250 12/78 (15%)
Ig strand B 1685..1689 CDD:409559 2/3 (67%)
Ig strand C 1697..1701 CDD:409559 1/3 (33%)
Ig strand E 1722..1726 CDD:409559 0/3 (0%)
Ig strand F 1736..1741 CDD:409559 0/4 (0%)
Ig strand G 1745..1748 CDD:409559 0/2 (0%)
Ig 1763..1842 CDD:472250 22/95 (23%)
Ig strand B 1777..1781 CDD:409559 1/3 (33%)
Ig strand C 1789..1793 CDD:409559 1/3 (33%)
Ig strand E 1814..1818 CDD:409559 1/3 (33%)
Ig strand F 1828..1833 CDD:409559 2/7 (29%)
Ig strand G 1837..1840 CDD:409559 0/2 (0%)
Ig 1855..1934 CDD:472250 23/116 (20%)
Ig strand B 1869..1873 CDD:409559 1/3 (33%)
Ig strand C 1881..1885 CDD:409559 1/11 (9%)
Ig strand E 1906..1910 CDD:409559 1/3 (33%)
Ig strand F 1920..1925 CDD:409559 1/4 (25%)
Ig strand G 1929..1932 CDD:409559 0/2 (0%)
Ig 1947..2026 CDD:472250 20/110 (18%)
Ig strand B 1961..1965 CDD:409559 0/3 (0%)
Ig strand C 1973..1977 CDD:409559 1/3 (33%)
Ig strand E 1998..2002 CDD:409559 1/3 (33%)
Ig strand F 2012..2017 CDD:409559 2/4 (50%)
Ig strand G 2021..2024 CDD:409559 0/2 (0%)
Ig 2051..2119 CDD:472250 5/67 (7%)
Ig strand B 2052..2056 CDD:409559 0/3 (0%)
Ig strand C 2064..2068 CDD:409559 0/3 (0%)
Ig strand E 2089..2093 CDD:409559 0/3 (0%)
Ig strand F 2103..2108 CDD:409559 0/4 (0%)
Ig strand G 2112..2115 CDD:409559 1/2 (50%)
Ig 2125..2207 CDD:472250 25/85 (29%)
Ig strand B 2141..2145 CDD:409559 1/3 (33%)
Ig strand C 2153..2157 CDD:409559 1/7 (14%)
Ig strand E 2178..2182 CDD:409559 1/3 (33%)
Ig strand F 2192..2197 CDD:409559 2/4 (50%)
Ig strand G 2201..2204 CDD:409559 0/2 (0%)
IG_like 2221..2299 CDD:214653 9/79 (11%)
Ig strand B 2231..2235 CDD:409559 1/3 (33%)
Ig strand C 2243..2247 CDD:409559 0/3 (0%)
Ig strand E 2268..2272 CDD:409559 2/5 (40%)
Ig 2305..2388 CDD:472250 20/89 (22%)
Ig strand B 2320..2324 CDD:409543 1/3 (33%)
Ig strand C 2332..2336 CDD:409543 1/3 (33%)
Ig strand E 2357..2361 CDD:409543 1/3 (33%)
Ig strand F 2371..2376 CDD:409543 2/4 (50%)
Ig 2398..2476 CDD:472250 11/79 (14%)
Ig 2482..2565 CDD:472250 26/89 (29%)
Ig strand B 2498..2502 CDD:409559 1/3 (33%)
Ig strand C 2510..2514 CDD:409559 1/3 (33%)
Ig strand E 2535..2539 CDD:409559 0/3 (0%)
Ig strand F 2549..2554 CDD:409559 3/4 (75%)
Ig strand G 2558..2561 CDD:409559 1/2 (50%)
Ig 2571..2654 CDD:472250 19/117 (16%)
Ig strand B 2587..2591 CDD:409543 1/6 (17%)
Ig strand C 2599..2603 CDD:409543 0/3 (0%)
Ig strand E 2624..2628 CDD:409543 1/3 (33%)
Ig strand F 2638..2643 CDD:409543 0/4 (0%)
Ig strand G 2647..2650 CDD:409543 0/2 (0%)
Ig 2660..2743 CDD:472250 17/85 (20%)
Ig strand B 2676..2680 CDD:409559 1/3 (33%)
Ig strand C 2688..2692 CDD:409559 1/3 (33%)
Ig strand E 2713..2717 CDD:409559 1/3 (33%)
Ig strand F 2727..2732 CDD:409559 3/4 (75%)
Ig strand G 2736..2739 CDD:409559 0/2 (0%)
I-set 2839..2922 CDD:400151 27/89 (30%)
Ig strand B 2855..2859 CDD:409353 2/3 (67%)
Ig strand C 2868..2871 CDD:409353 2/2 (100%)
Ig strand E 2892..2896 CDD:409353 1/3 (33%)
Ig strand F 2906..2911 CDD:409353 3/4 (75%)
Ig 2928..3011 CDD:472250 13/89 (15%)
Ig strand C 2956..2960 CDD:409353 0/3 (0%)
Ig strand E 2981..2985 CDD:409353 0/3 (0%)
Ig 3033..>3087 CDD:409353 16/56 (29%)
Ig strand B 3033..3037 CDD:409353 1/3 (33%)
Ig strand C 3043..3049 CDD:409353 1/5 (20%)
Ig strand E 3070..3074 CDD:409353 2/3 (67%)
Ig 3107..3190 CDD:472250 24/91 (26%)
Ig strand B 3122..3126 CDD:409405 1/3 (33%)
Ig strand C 3135..3139 CDD:409405 0/3 (0%)
Ig strand E 3160..3164 CDD:409405 1/3 (33%)
Ig strand F 3174..3179 CDD:409405 1/4 (25%)
Ig 3196..3266 CDD:472250 15/83 (18%)
Ig strand B 3212..3216 CDD:409559 0/3 (0%)
Ig strand C 3224..3228 CDD:409559 1/3 (33%)
Ig strand E 3249..3253 CDD:409559 0/3 (0%)
Ig 3285..3368 CDD:472250 22/131 (17%)
Ig strand B 3301..3305 CDD:409562 0/3 (0%)
Ig strand C 3313..3316 CDD:409562 1/2 (50%)
Ig strand E 3338..3342 CDD:409562 2/18 (11%)
Ig 3374..3459 CDD:472250 26/124 (21%)
Ig strand B 3390..3394 CDD:409405 0/3 (0%)
Ig strand C 3403..3407 CDD:409405 1/5 (20%)
Ig strand E 3429..3433 CDD:409405 2/3 (67%)
Ig strand G 3452..3455 CDD:409405 1/2 (50%)
Ig 3466..3548 CDD:472250 27/100 (27%)
Ig strand B 3481..3485 CDD:409559 1/3 (33%)
Ig strand C 3493..3497 CDD:409559 1/3 (33%)
Ig strand E 3518..3522 CDD:409559 1/3 (33%)
Ig strand F 3532..3537 CDD:409559 2/4 (50%)
Ig strand G 3541..3544 CDD:409559 1/2 (50%)
Ig 3554..3637 CDD:472250 22/124 (18%)
Ig strand B 3570..3574 CDD:409353 1/19 (5%)
Ig strand C 3582..3586 CDD:409353 1/3 (33%)
Ig strand E 3607..3611 CDD:409353 1/3 (33%)
Ig strand F 3621..3625 CDD:409353 2/7 (29%)
Ig strand G 3634..3637 CDD:409353 1/2 (50%)
Ig 3644..3726 CDD:472250 27/103 (26%)
Ig strand B 3659..3663 CDD:409559 1/4 (25%)
Ig strand C 3671..3675 CDD:409559 0/3 (0%)
Ig strand E 3696..3700 CDD:409559 2/3 (67%)
Ig strand F 3710..3715 CDD:409559 3/4 (75%)
Ig strand G 3719..3722 CDD:409559 0/2 (0%)
Ig 3732..3815 CDD:472250 21/90 (23%)
Ig strand B 3748..3752 CDD:409559 0/3 (0%)
Ig strand C 3760..3764 CDD:409559 1/3 (33%)
Ig strand E 3785..3789 CDD:409559 2/3 (67%)
Ig strand F 3799..3804 CDD:409559 2/4 (50%)
Ig strand G 3808..3811 CDD:409559 1/2 (50%)
Ig 3826..3904 CDD:472250 10/77 (13%)
Ig strand B 3837..3841 CDD:409543 0/3 (0%)
Ig strand C 3849..3853 CDD:409543 0/3 (0%)
Ig strand E 3874..3878 CDD:409543 0/3 (0%)
Ig strand F 3888..3893 CDD:409543 1/4 (25%)
Ig strand G 3897..3900 CDD:409543 0/2 (0%)
I-set 3909..3993 CDD:400151 26/91 (29%)
Ig strand B 3926..3930 CDD:409353 1/3 (33%)
Ig strand C 3938..3942 CDD:409353 2/3 (67%)
Ig strand E 3963..3967 CDD:409353 1/3 (33%)
Ig strand F 3977..3981 CDD:409353 1/3 (33%)
Ig 3997..4082 CDD:472250 9/84 (11%)
Ig strand B 4015..4019 CDD:409353 1/3 (33%)
Ig strand C 4027..4031 CDD:409353 0/3 (0%)
Ig strand E 4052..4056 CDD:409353 0/3 (0%)
Ig 4089..4171 CDD:472250 27/89 (30%)
Ig strand B 4104..4108 CDD:409353 0/3 (0%)
Ig strand C 4116..4120 CDD:409353 2/3 (67%)
Ig strand E 4141..4145 CDD:409353 1/3 (33%)
Ig strand F 4155..4159 CDD:409353 2/3 (67%)
Ig 4182..4260 CDD:472250 20/116 (17%)
Ig strand B 4193..4197 CDD:409353 1/3 (33%)
Ig strand C 4205..4209 CDD:409353 1/3 (33%)
Ig strand E 4230..4234 CDD:409353 1/3 (33%)
Ig strand F 4244..4248 CDD:409353 2/3 (67%)
Ig 4265..4349 CDD:472250 16/92 (17%)
Ig strand B 4282..4286 CDD:409559 1/3 (33%)
Ig strand C 4294..4298 CDD:409559 0/11 (0%)
Ig strand E 4319..4323 CDD:409559 2/3 (67%)
Ig strand F 4333..4338 CDD:409559 0/4 (0%)
Ig strand G 4342..4345 CDD:409559 0/2 (0%)
Ig 4354..4438 CDD:472250 25/92 (27%)
Ig strand B 4371..4375 CDD:409353 0/3 (0%)
Ig strand C 4383..4387 CDD:409353 2/4 (50%)
Ig strand E 4408..4412 CDD:409353 2/3 (67%)
Ig strand G 4431..4434 CDD:409353 1/2 (50%)
Ig 4443..4527 CDD:472250 21/95 (22%)
Ig strand B 4460..4464 CDD:409559 0/3 (0%)
Ig strand C 4472..4476 CDD:409559 1/3 (33%)
Ig strand E 4497..4501 CDD:409559 0/3 (0%)
Ig strand F 4511..4516 CDD:409559 2/4 (50%)
Ig strand G 4520..4523 CDD:409559 1/2 (50%)
Ig 4533..4616 CDD:472250 17/137 (12%)
Ig strand B 4549..4553 CDD:409353 1/4 (25%)
Ig strand C 4562..4565 CDD:409353 1/2 (50%)
Ig strand E 4586..4590 CDD:409353 0/3 (0%)
Ig strand F 4600..4604 CDD:409353 2/7 (29%)
Ig 4623..4705 CDD:472250 25/86 (29%)
Ig strand B 4638..4642 CDD:409353 2/3 (67%)
Ig strand C 4650..4654 CDD:409353 2/3 (67%)
Ig strand E 4675..4679 CDD:409353 1/3 (33%)
Ig strand F 4689..4693 CDD:409353 0/3 (0%)
Ig 4716..4794 CDD:472250 21/84 (25%)
Ig strand B 4727..4731 CDD:409559 2/3 (67%)
Ig strand C 4739..4743 CDD:409559 0/3 (0%)
Ig strand E 4764..4768 CDD:409559 1/3 (33%)
Ig strand F 4778..4783 CDD:409559 2/4 (50%)
Ig strand G 4787..4790 CDD:409559 0/2 (0%)
Ig 4800..4883 CDD:472250 18/85 (21%)
Ig strand B 4816..4820 CDD:409353 1/3 (33%)
Ig strand C 4828..4832 CDD:409353 0/3 (0%)
Ig strand E 4853..4857 CDD:409353 2/3 (67%)
Ig strand F 4867..4871 CDD:409353 1/3 (33%)
Ig 4890..4973 CDD:472250 23/87 (26%)
Ig strand B 4905..4909 CDD:409559 1/3 (33%)
Ig strand C 4917..4921 CDD:409559 1/3 (33%)
Ig strand E 4942..4946 CDD:409559 1/3 (33%)
Ig strand F 4956..4961 CDD:409559 3/4 (75%)
Ig strand G 4965..4968 CDD:409559 1/2 (50%)
Ig 4978..5061 CDD:472250 19/88 (22%)
Ig strand B 4994..4998 CDD:409353 0/3 (0%)
Ig strand C 5006..5010 CDD:409353 1/3 (33%)
Ig strand E 5031..5035 CDD:409353 1/3 (33%)
Ig 5068..5150 CDD:472250 30/100 (30%)
Ig strand B 5083..5087 CDD:409353 1/3 (33%)
Ig strand C 5095..5099 CDD:409353 0/3 (0%)
Ig strand E 5120..5124 CDD:409353 1/3 (33%)
I-set 5154..5237 CDD:400151 24/100 (24%)
Ig strand B 5170..5174 CDD:409353 3/3 (100%)
Ig strand C 5182..5186 CDD:409353 2/3 (67%)
Ig strand E 5207..5211 CDD:409353 1/3 (33%)
Ig strand F 5221..5226 CDD:409353 2/4 (50%)
IG_like 5249..5328 CDD:214653 12/81 (15%)
Ig 5333..5417 CDD:472250 17/97 (18%)
Ig strand B 5350..5354 CDD:409353 0/3 (0%)
Ig strand C 5363..5366 CDD:409353 1/15 (7%)
Ig strand E 5387..5391 CDD:409353 0/3 (0%)
Ig strand F 5401..5406 CDD:409353 0/4 (0%)
Ig 5426..5499 CDD:472250 17/100 (17%)
Ig strand B 5439..5443 CDD:409559 1/3 (33%)
Ig strand C 5451..5455 CDD:409559 2/10 (20%)
Ig strand E 5476..5480 CDD:409559 1/3 (33%)
Ig strand F 5490..5495 CDD:409559 0/4 (0%)
Ig 5511..5597 CDD:472250 16/86 (19%)
Ig strand B 5528..5532 CDD:409405 1/3 (33%)
Ig strand C 5541..5545 CDD:409405 1/4 (25%)
Ig strand E 5567..5571 CDD:409405 0/3 (0%)
Ig strand G 5590..5593 CDD:409405 0/2 (0%)
Ig 5604..5686 CDD:472250 17/81 (21%)
Ig strand B 5619..5623 CDD:409353 0/3 (0%)
Ig strand C 5632..5635 CDD:409353 0/2 (0%)
Ig strand E 5656..5660 CDD:409353 0/3 (0%)
Ig strand F 5670..5675 CDD:409353 0/4 (0%)
Ig 5693..5775 CDD:472250 16/96 (17%)
Ig strand B 5708..5712 CDD:409353 0/3 (0%)
Ig strand C 5720..5724 CDD:409353 1/3 (33%)
Ig strand E 5745..5749 CDD:409353 1/3 (33%)
Ig strand G 5768..5771 CDD:409353 1/2 (50%)
Ig 5781..5866 CDD:472250 7/84 (8%)
Ig strand B 5797..5801 CDD:409405 0/3 (0%)
Ig strand C 5810..5814 CDD:409405 1/3 (33%)
Ig strand E 5836..5840 CDD:409405 0/3 (0%)
Ig strand G 5859..5862 CDD:409405 0/2 (0%)
IG_like 5878..5951 CDD:214653 12/118 (10%)
Ig strand B 5888..5892 CDD:409353 1/49 (2%)
Ig strand C 5899..5903 CDD:409353 0/3 (0%)
Ig strand E 5925..5929 CDD:409353 0/3 (0%)
Ig strand F 5939..5944 CDD:409353 1/4 (25%)
Ig 5962..6046 CDD:472250 18/107 (17%)
Ig strand B 5976..5980 CDD:409405 0/3 (0%)
Ig strand C 5989..5993 CDD:409405 1/3 (33%)
Ig strand E 6016..6020 CDD:409405 0/3 (0%)
Ig strand F 6030..6035 CDD:409405 2/4 (50%)
Ig strand G 6039..6042 CDD:409405 0/2 (0%)
Ig 6052..>6121 CDD:472250 24/145 (17%)
FN3 6141..6226 CDD:238020 16/101 (16%)
Ig 6242..6319 CDD:472250 21/102 (21%)
Ig strand B 6255..6259 CDD:409559 1/3 (33%)
Ig strand C 6267..6271 CDD:409559 2/3 (67%)
Ig strand E 6292..6296 CDD:409559 1/3 (33%)
Ig strand F 6306..6312 CDD:409559 0/5 (0%)
Ig strand G 6316..6319 CDD:409559 2/4 (50%)
I-set 6542..6625 CDD:400151 13/99 (13%)
Ig strand B 6552..6556 CDD:409353 0/3 (0%)
Ig strand C 6565..6569 CDD:409353 0/3 (0%)
Ig strand E 6591..6595 CDD:409353 0/3 (0%)
Ig strand F 6605..6610 CDD:409353 1/4 (25%)
Ig strand G 6618..6621 CDD:409353 0/2 (0%)
I-set 6783..6873 CDD:400151 21/112 (19%)
Ig strand B 6800..6804 CDD:409405 0/3 (0%)
Ig strand C 6813..6817 CDD:409405 1/3 (33%)
Ig strand E 6839..6843 CDD:409405 0/3 (0%)
Ig strand F 6853..6858 CDD:409405 0/4 (0%)
Ig strand G 6866..6869 CDD:409405 0/2 (0%)
I-set 6915..7005 CDD:400151 29/89 (33%)
Ig strand B 6933..6937 CDD:409543 0/3 (0%)
Ig strand C 6946..6950 CDD:409543 0/3 (0%)
Ig strand E 6971..6975 CDD:409543 1/3 (33%)
Ig strand F 6985..6990 CDD:409543 1/4 (25%)
Ig strand G 6998..7001 CDD:409543 1/2 (50%)
I-set 7029..7124 CDD:400151 24/109 (22%)
Ig strand B 7046..7050 CDD:409405 1/3 (33%)
Ig strand C 7059..7063 CDD:409405 1/6 (17%)
Ig strand E 7090..7094 CDD:409405 0/3 (0%)
Ig strand F 7104..7109 CDD:409405 1/4 (25%)
Ig strand G 7117..7120 CDD:409405 1/2 (50%)
SH3_Obscurin_like 7261..7323 CDD:212958 6/61 (10%)
RhoGEF 7357..7533 CDD:459876 22/176 (13%)
PH-like 7542..7665 CDD:473070 26/152 (17%)
IgI_1_Titin-A168_like 7674..7764 CDD:409563 28/90 (31%)
Ig strand A' 7679..7685 CDD:409563 1/6 (17%)
Ig strand B 7690..7698 CDD:409563 2/7 (29%)
Ig strand C 7704..7709 CDD:409563 2/4 (50%)
Ig strand C' 7712..7714 CDD:409563 0/1 (0%)
Ig strand D 7720..7727 CDD:409563 1/6 (17%)
Ig strand E 7730..7736 CDD:409563 1/5 (20%)
Ig strand F 7743..7751 CDD:409563 2/7 (29%)
Ig strand G 7754..7764 CDD:409563 3/9 (33%)
Ig 7767..7857 CDD:472250 30/89 (34%)
Ig strand B 7785..7789 CDD:409353 2/3 (67%)
Ig strand C 7798..7802 CDD:409353 1/3 (33%)
Ig strand E 7825..7829 CDD:409353 1/3 (33%)
Ig strand F 7839..7844 CDD:409353 3/4 (75%)
Ig strand G 7852..7855 CDD:409353 0/2 (0%)
I-set 8036..8123 CDD:400151 21/121 (17%)
Ig strand B 8053..8057 CDD:409353 1/3 (33%)
Ig strand C 8066..8070 CDD:409353 0/13 (0%)
Ig strand E 8091..8095 CDD:409353 1/3 (33%)
Ig strand F 8105..8110 CDD:409353 1/4 (25%)
Ig strand G 8118..8121 CDD:409353 0/2 (0%)
Protein Kinases, catalytic domain 8145..8400 CDD:473864 59/370 (16%)
I-set 9397..9485 CDD:400151 19/100 (19%)
Ig strand B 9414..9418 CDD:409544 1/3 (33%)
Ig strand C 9426..9430 CDD:409544 1/3 (33%)
Ig strand E 9452..9456 CDD:409544 0/3 (0%)
Ig strand F 9466..9471 CDD:409544 0/4 (0%)
FN3 9493..9568 CDD:214495 18/85 (21%)
Protein Kinases, catalytic domain 9601..9855 CDD:473864 27/137 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.