DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sls and speg

DIOPT Version :10

Sequence 1:NP_001261304.1 Gene:sls / 44013 FlyBaseID:FBgn0086906 Length:18468 Species:Drosophila melanogaster
Sequence 2:XP_031748703.1 Gene:speg / 100486621 XenbaseID:XB-GENE-984260 Length:3808 Species:Xenopus tropicalis


Alignment Length:4715 Identity:874/4715 - (18%)
Similarity:1489/4715 - (31%) Gaps:1603/4715 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  2995 QHPKGAEGLEQIQDLEDSLRKDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPVGDQ 3059
            :|||.|                 ::|.||.   ||:|..:..|.| ||.|  ......:...|..
 Frog    36 KHPKLA-----------------AEPGQPS---PPQFVRKLKNAA-IGTG--CDICLKVAVAGHP 77

  Fly  3060 SMVIEWFYNGKVLEASHRVRTIYAFGTVALEVLGTKIEDTGTYTCRATNKHG---TAEISCNLEC 3121
            ...:.|:.|.:.::....     .:||:.:.  .:::||.|.|||.|.|..|   |:.:...:|.
 Frog    78 LPTLNWYKNQERIQPGGE-----EYGTLCIR--DSRMEDAGVYTCVAQNPLGEAITSAVLAIIEL 135

  Fly  3122 VDKPRGQK----PRFTSHIQ-----PLEGLKDGQSAHF--------ECTLIPVNDPDLKVEW--- 3166
            .|...|::    |:....|:     || |...|.|...        ..||..::..|...:|   
 Frog   136 EDSEPGEEDAGGPQLQRTIRAPNNTPL-GTPSGDSDTLLASSLHTTPSTLTALSQTDELSDWSGS 199

  Fly  3167 ---------------YHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNK------ 3210
                           :..|...||              |.:..|....|.|:....|..      
 Frog   200 QQTVLERDPRNARQGFTQGGGARH--------------LGVEPLIPASSNEFPGSVWGSEVSLSG 250

  Fly  3211 ----YGEDFT---------RTTLNCGG--RG---GVFYDS----------LQPDSLQRI--RELE 3245
                |...|:         |..|..||  ||   |...||          :.|....||  |...
 Frog   251 FSDLYSSAFSLYRGRSCAIRVFLPEGGLRRGSINGSVTDSPRNFVNPRPPIIPPPSPRIGQRPAV 315

  Fly  3246 CPQGQQADTSAPLVAEPPKFIT---QIVD-VTKLVE-----------GQSAHFEAR-LTPITDPD 3294
            .|.|:    ..|....|.|..|   |..| ||:.:|           .|::..::| :||:::..
 Frog   316 IPAGR----GPPTPVTPRKKTTMPNQYQDTVTEELEEKIKKPKSSVGSQASGQDSRPVTPLSETS 376

  Fly  3295 LVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENS----------------GVYEARARNK 3343
            ..|.......||...         |..|.:.|.|.||..                .:.:||:.::
 Frog   377 GRVSILRASPKLVRS---------GSKIFEKLRCLEERRKSLDQTDSPFPVHSWLPLRKARSFDQ 432

  Fly  3344 YGEDVTRASLKCASKSSLILDSQLPRGME---GGLE---------------------KIANLE-- 3382
            .|.:...|.|..:::.   |...|..|:.   ||..                     :|:::|  
 Frog   433 PGAEGLGAGLGSSNEE---LRDDLRDGVRSEIGGFTLRYPSLRHKTTSLDDRGALYGRISDIETR 494

  Fly  3383 YSMVRTREETT----------EETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKL-KV- 3435
            :|...||.:.|          ::..|::|              .......|:..|. |||| || 
 Frog   495 FSQELTRIKRTVSQQQLVRSSQDLSGRSP--------------SPQRSLAAQPAPV-DPKLTKVS 544

  Fly  3436 ---------EWYWNGRPLKAGSRFRTFCDFGFVILEIS---------PVYPEDSGEYSCRAINEY 3482
                     |.....:||     .|:|.... .:.||.         |..|..|...|.    .|
 Frog   545 TAPKPSETEEKQPARKPL-----VRSFATVN-QLSEIKEPLGFSSQPPTLPSKSSNGSA----VY 599

  Fly  3483 GEAV--TTATMKIQ----GKRSII----MESQLPKGMEGTIDRIAELEGLGSRSTEFVPDDDTGK 3537
            .:||  :...||.|    ||  ||    :..|:.|.|  |:...::.|.:|....:.|||..:..
 Frog   600 QDAVRHSETNMKSQPHLTGK--IIAPKTVSPQVFKAM--TLPAQSQKEAVGDTQPKRVPDVGSVP 660

  Fly  3538 PPEFITSPFDMVIGENALAHFECRLQPINDPSMRVDWFHNGKALWAGSRIKTINDFGFVILEIAG 3602
            ||....:|..:.|.:..|..   ....:::....:.|     ||..|....:....|    :..|
 Frog   661 PPPSTHAPAALEIAQRGLVK---EKGTVSEEKKYLPW-----ALPVGDNNNSQMPQG----KGGG 713

  Fly  3603 CYQRDSGLYTCKATNKHGEATVSCKLQVKGRQGIVMEPQLPSNFRTGTESLQKLEETMHKREELV 3667
            ..::.|..:|...:||.|.:      :.|.|:...:.|:|.|:                 .:..|
 Frog   714 QAKKHSDAHTSSKSNKSGRS------KGKSRRSRPLSPELESS-----------------DDSYV 755

  Fly  3668 TEDEQP-NPPKFTEEIKDNLDVPEGGPIHFDCRVEPVGDPTMRIEWFYNGHVMATGSRVHQLNDF 3731
            :..|.| ..|.|...::..| |..|..:...|.:.  |:|:..:.| ...||:...|..||:...
 Frog   756 SAGEDPAEAPVFEIPLQSAL-VNAGTEVLLKCIIS--GNPSPEVFW-RKDHVLLKNSPTHQIRVE 816

  Fly  3732 G-FIALDVDYIYARDSGEYTCRATNKWGTATTSAKVTCK---GKHNIVYES---QLPEGMTS--E 3787
            | ...|.:.:....|||.||..|.|:.|.|::...:|.|   .|.:..:..   .|...:||  |
 Frog   817 GERHTLLLRWALPSDSGIYTVTARNEVGEASSCGALTVKPAPTKESPAHRGTPRDLLSPITSDEE 881

  Fly  3788 KLKELERGRIPEAPKVVEEVFG-------PPKFTTQITSVTVDEAEAVRFECQVEPKTDPSLRVE 3845
            .|...|....|..|:  .::.|       ||.|...:......|.:.:....|||.:..|.  :.
 Frog   882 YLSPQEDLSEPTTPQ--HKMAGKGPAFKAPPTFKMPLLDQKGFEGQEIVLSVQVEGEPKPI--IN 942

  Fly  3846 WYRNGKPLPSGHRYRNIFD--MGFVSLDILYVYGEDSGEYVCRAINNYGEDRTRATVSCKKLPTI 3908
            |.:|.:.:..|.|:| |.:  .|..||.|......|||.|.|:|||.||      |..|:....:
 Frog   943 WLKNKQQVKPGGRFR-ISEGAWGIFSLHIAGADKRDSGFYTCKAINEYG------TKQCEAKIEV 1000

  Fly  3909 LLQNQVPRGMKRSDALTQMEATIKKYTSEVHLTEDDLFDPDRKQPPRFVTQIKEQLTLTEMAVTK 3973
            |    .|.|....:.|..::..                                .:...|.||  
 Frog  1001 L----APPGSTSLEVLAPLQDV--------------------------------SVCAGEAAV-- 1027

  Fly  3974 FECQLAPVGDPNMKVEWFFNGKPLLHKNRFQPI-------YDFGYVAMNFGWVYPEDSGEYVCRA 4031
            |||.::  |..:|.|:|.|.||.|      ||.       ::.....:....|:.:|||.|.|:.
 Frog  1028 FECVVS--GPADMDVDWMFRGKLL------QPALLDCKMRFNGKQCVLLLNSVHEDDSGVYTCKL 1084

  Fly  4032 TNLYGKDETRAIIKVSGKPGIVYDSQLPAHMQSIDRIREMEASWQVVPDEVDPDAKPRTKPVFVS 4096
            :.  .:||            :...:.|..|                          |...|:|..
 Frog  1085 ST--ARDE------------LTCSAMLTVH--------------------------PSLAPLFTR 1109

  Fly  4097 KLEPQTVEEGDPARFCVRVTGHPRPRVMWLINGHTVVHGSRYKLTNDGMFH-LDVPKTRQYDTGK 4160
            ||..:.|.||..||...:::|.|.|.|.|...|..:.......:..:|..| |.:|.....|.|:
 Frog  1110 KLSDRDVIEGRTARLDCKISGTPPPVVTWTHFGQPIEESENIHVLREGGHHTLLIPHVANEDEGQ 1174

  Fly  4161 VEVIARNSVGESIATTELKVVARSDDYRNVLKNSPRPWYDYELAAYQKERQENELEKVFDERKQV 4225
            ....|.|..||:..:.||.|            ..||                             
 Frog  1175 YTATAHNKHGEAECSAELYV------------EEPR----------------------------- 1198

  Fly  4226 LSEQSSHTLKGVEHLKPKQYKPPTPDWQQNVKAKKSEDYYNKLQTLETEQLLKETNLRRDTHQYA 4290
             |..:||                                .:||:.:.                 :
 Frog  1199 -SATASH--------------------------------ISKLEKMP-----------------S 1213

  Fly  4291 IPGEKVVSSSQAKGMAQSYEENLQEKTSTTEVQAAPPKGIAQPSESSVHGREVHMNKQQQVQKEI 4355
            ||.|                         .|:|....:|:..|.                     
 Frog  1214 IPEE-------------------------PEMQECEVEGVMMPD--------------------- 1232

  Fly  4356 QGDLEITRKITATETTEVEHKGTIQERVVQGPVKPAKAPVFTKKIQPCRVFENEQAKFEVEFEGE 4420
                                                    |.:.:|...|.|..:.:.|.:..|.
 Frog  1233 ----------------------------------------FLRPLQDIDVVEFREVQLECQVTGL 1257

  Fly  4421 PNPTVKWYRESFPIQNSPDLQIHTFSGKSILIIRQVFVEDSAVFSCVAENRGGTAKCSANLVVEE 4485
            |.||:.||.....||:|.|.::..:.....|:...|....:.|:..|..|:.|.|.|.|:|.|.:
 Frog  1258 PYPTITWYHNGQKIQSSDDRRMTQYKDIHRLVFPSVTHSHAGVYKSVISNKVGKAACYAHLYVTD 1322

  Fly  4486 RRRAGKGGIQPPSFVTTIQSTTVATGQLARFDAKVTGTRPLDVYWLKNGMKIQPSIKFKMLEEDS 4550
            .......|   |..:|::      ||::.:            :.| |...::.|:|       |.
 Frog  1323 LVPTPPDG---PPIITSV------TGRIVK------------LQW-KPPKRLDPAI-------DL 1358

  Fly  4551 VHTLLIIEPFAEDSGRYECVAVNAAGEARCDGDCIVQS---------------PSKPEKPTTPGS 4600
            ......::..|..|.::..:..|......|     |:|               |:...||:.|..
 Frog  1359 AQITYSVQQQAVGSPQWTVITTNLKDTCYC-----VRSLTKEHQYLFRVTTNTPTSHSKPSPPSE 1418

  Fly  4601 -----EKAPHIVEQLKSQTVEEGSKVIFRCRVDGKP---TPT-------ARWMRGENFV-KPSRY 4649
                 .:.|::.|.   .::.:..::::  .|:.:|   |.|       ..|.|.:..: .....
 Frog  1419 SVCLFNRGPYLEEM---PSILDRPEILY--MVENQPLCITVTLNHVHAKVTWQRIDTVLSNVEGV 1478

  Fly  4650 FQMSR-QGEYYQLVISEAFPEDEGTYKCVAENKLGSIQTSAQLKVRPIENLDAPPTITALKDVSV 4713
            :::|. ..:.:.|.:......|.|.....|:|:.||...:..     ||..:||...:.::|:.:
 Frog  1479 YELSMPDDDQHSLTLFSPRKSDLGQLTFEAKNRYGSDSCTIS-----IELAEAPRFESIMEDIEI 1538

  Fly  4714 TEGMPAQFKTTVTGKVKATSVQWFREGQLIPETPDFQMIFDGNSAVLLIGTTYEEDSGIFTVRVT 4778
            ..|..|:|...|.|| ....:.|:::|.|:.|:..|..::|.....|:|..|...|||::|....
 Frog  1539 GVGETARFVVVVEGK-PIPDIMWYKDGVLLAESGHFSFVYDDTECSLVILNTALGDSGVYTCTAR 1602

  Fly  4779 SSTGQVESSAKLTVKKRRISAFQLRTIDSAEDESSSSGREDSAPESPHAFQPGQQ----PGQQFG 4839
            :.:|::...|:|.|                            .|:.|.|....|:    ..::..
 Frog  1603 NLSGEISCKAELQV----------------------------CPDEPGAGSAIQEIDILKVRRLT 1639

  Fly  4840 QFLGVNGQGQHQGRSRQKKPKVRSKSLQPATKVIPWRKSSRPTRGRSLDKGVFLPGFKPEPVKSW 4904
            .|..::.:......|..:....:|.....|.|.||:|.::|.:..|..|           .:...
 Frog  1640 DFYNIHKEIGRGAFSYVRHVVEKSNGRDLAAKFIPFRGATRESARRERD-----------ILSKL 1693

  Fly  4905 TEETINLKATPIEKKKPAPKLEAAKVVLKSIKTERDQGIMSLGATLEQIIAGKTEKEAIPWITMR 4969
            ..:.|.......||:       :|.:::..:.::.:        .||::....|..|:.....:|
 Frog  1694 RHDRIIFFYDAFEKR-------SALIIVMELCSQEE--------LLERLTRKPTVSESEIRSFIR 1743

  Fly  4970 EKLKAVESVQQQLNKFDLDEVYLQPLEGQIETEGQLPQQAQVEQVQRTKEIQRLKSMESVEIMEM 5034
            :.|:.::.:..: |...||          |:.|..|......||::                   
 Frog  1744 QILEGLDYLHHK-NILHLD----------IKPENILMADTTSEQIR------------------- 1778

  Fly  5035 TDQIDKLITQQQNAKDLIPWKEMRQQLKSVQRVTKQI----------DKFKIEEVELRHLQAQQA 5089
                   |....||::|.|......:..:.:.|..:|          |.:.:..:....|.....
 Frog  1779 -------ICDFGNAQELTPGDPQYCKYGTPEFVAPEIVNQMPISTVTDIWPVGVLAYLCLTGVSP 1836

  Fly  5090 ITEE-----------YQTGTAEETVVMIDESSKGSISKVL-------RRDEQLQYEDQSNIYKQK 5136
            ...|           |.....|:..|.:...::|.:.|||       ..:|.|::.....:.|.|
 Frog  1837 FVGENDYTTLMNIRGYTVAFEEKMFVGLTREARGFLIKVLGNEKLRPNAEESLEHPWFKTLAKGK 1901

  Fly  5137 FITTEDVNIMHVSEREKLEAQRLIREQQAVNWRQQQQRPQL-----------QPLTSVEDTVISQ 5190
            .|:|:.:.:.  ..|.|.:...:..:...|    .:..|:|           .|..|.|.:.:|.
 Frog  1902 SISTDHLKLF--QSRRKWQRSLISYKSNMV----MRTIPELLQDTSNHLSIAVPKNSKEASGLSS 1960

  Fly  5191 TSERQKLVQQQSFIEEAQRQQFVQVEDSQMMSLEEYEHQKIINQRTQQEAFSWRQPREPQKFIQV 5255
            :|:...| ::..|:....:.||    ....|||.|.                             
 Frog  1961 SSDSDDL-EELPFVPMPLQVQF----SGSRMSLNEI----------------------------- 1991

  Fly  5256 EDSTLLHLQERHDTQEQQLLQQQPVMWDRGRKKPDQPQYVQPQEQRVKEEFVEKPKTYEEMHDEL 5320
                        .|.|:||.|.|    |.|..:.|:.:..|.         ||...|::|     
 Frog  1992 ------------PTDEEQLSQPQ----DNGSCREDEEEGSQA---------VEISSTFKE----- 2026

  Fly  5321 VEPTPIEQPQPVPVMWERGKKKPQPQEKTFEEAHDELVEPTPVQQPEPVPVMWERGKKKVAQQET 5385
                     |.|           |.:|.|        |:.:|:.         :..|..:.:.. 
 Frog  2027 ---------QAV-----------QQKEAT--------VQASPLS---------KHAKGTLTRNR- 2053

  Fly  5386 VLSQEVVQTSQVVEQQIVEETKKTAVRRVIPPREPEQK--------VEQVTLKPTPRPRPKEAVK 5442
              |.||..:|.       |||.:|..|.  .||.|.:|        |....:|...|...:....
 Frog  2054 --SAEVGSSSD-------EETSETEKRE--HPRRPLKKGSSLESADVPDGEIKAARRGELRRGSS 2107

  Fly  5443 AEEIQLKPLRSTRPVPQPVEAEQKAYEEATDELTEEPIPQPQPVMWE-RGKKKPQKPQEEVTEIP 5506
            |:...|..:.:|....:....::...:.|:.||   |.....|...| ||               
 Frog  2108 ADSALLLNVSTTDGDEERDRPDKGMIKAASMEL---PTRCRSPGRLEDRG--------------- 2154

  Fly  5507 KTLEIAVDTLEEEVPKPTEPQPQPVLWARGQKKPQKPDEQKQELPKSLEIAVDTIEEDLIK---- 5567
             ||.....:.:||..:..|...|.:|  ||.....|....:..|.::|.:.....|:..|:    
 Frog  2155 -TLRRKFGSADEEYAQRLEMMRQRLL--RGGSADGKLSGLRGPLIETLSVDKKRAEQISIRSPRS 2216

  Fly  5568 ---PVQPEPQPVLWERKKKKPQP-QDVIEEKLDVAPTKTYEKAVDVLPDEPKVEEKPEPVLWQRG 5628
               .:.|.|...|......:..| ::..||:: :..|.::.            ....||::..| 
 Frog  2217 DQSSLSPIPAIKLTRAASSEAAPGREATEERV-LRKTSSFS------------HSDTEPLVLHR- 2267

  Fly  5629 KKKIPKSEPTEEVHPDEVDAQIETVVKEDEMIVEEKRRIKKTKRPKSTKEVTEELFEEQPEEEIS 5693
            :...|...|.         ||:|.               ::.|...|...:|:.| |.:|:   :
 Frog  2268 RSGAPLEIPL---------AQLEA---------------QRLKESPSLSALTDRL-ESRPQ---T 2304

  Fly  5694 PEEEVPQKEVIEEIEEIVEEKRRLKKTKKPKLTQQVTEEETPHEEIIKESEE----VVQEQEEIV 5754
            |.|.:|                   |:..|:..|...|...|..:..||:|:    ::|..::..
 Frog  2305 PREMIP-------------------KSLTPEAPQLKAESGEPETQSDKEAEKGTTPLIQHHKDKD 2350

  Fly  5755 EEKKKVKKVKKPKTV--AEKQLKEEEIPTEETVEEEETAEDQQLVVEESKKVKKVKKPTGTVEKT 5817
            ....|...:..|:..  .:|...:.|:|:.:|    |.|:|:                   :.:.
 Frog  2351 SNSLKDLVIVLPRVTPPLDKMASKTELPSIQT----ERAQDK-------------------IPRA 2392

  Fly  5818 DVEELP-----GEEVPVEEVPV-------EEVPEDVAPEEELIEEQEEIVDQDEIQEQKRKVKKA 5870
            || .||     .|.||.:..|:       ..||.:..|...|..|..:       .:::....:|
 Frog  2393 DV-NLPATTSSNETVPTKPPPLLLPSKQSLSVPPEPLPSSVLTNEMPK-------SKEEYSSSRA 2449

  Fly  5871 KKPKKTIEKTEIEIEEDQPEEEVLQEEIIGEQEEITERQRKVKSIKKPKKVVTEKTVDQTEQPEK 5935
            .|.|::|.||                       |.|::|.|:|                      
 Frog  2450 IKAKESISKT-----------------------ETTDQQDKIK---------------------- 2469

  Fly  5936 PEESQAEEVKETVTEEPKKPKPA-----PEEAKVEQVEKISLKPAPRKQRLLPE---KEQVEEVL 5992
                  |.:.:.|...| .|.||     |..|||:..:..::   |.....||:   ||::....
 Frog  2470 ------EPLPQAVVPLP-LPMPASQVLKPSTAKVQIADSPTM---PENDASLPQITGKEKLSSPA 2524

  Fly  5993 LKPVKKIVAVSE--------AEQPETPETEFE------------VKEFAITTTEDILDVTKKRVK 6037
            ::||.|..|:|.        .:.||.|||..|            .:|..|.|.:          .
 Frog  2525 VQPVDKTAAISSPYAAMIQTLQVPEEPETVVEECSKAPLKAQPVFQEIPIATGD----------A 2579

  Fly  6038 KKKPKTKVAAEESTEEPAEETEEFEEEATQPEEVQPVEEIPEEPQVKEVADERKTAPKPKPRKEE 6102
            |.:..::|..:|..:|.::|.:.....::..|.|         |.:..:..|.....|.|..:|.
 Frog  2580 KAQGISQVNNKEGKDELSQEPKLINTRSSSTENV---------PFISNIDSEEIFEAKFKRNREN 2635

  Fly  6103 IIEKVEEVALKRVTR----PKKELPQEATIEEVRLKPTQRTSIKPEEVKLEEVDLQHVEKKEDEI 6163
            .:.:    .||::||    .|......|:.||...:|:      |..|.||.:....:...|   
 Frog  2636 SLTR----GLKKLTRTWSEEKNLAAAHASREEEMYRPS------PVGVPLEFLVPAALGLHE--- 2687

  Fly  6164 VQEEKRKTRKVKKPKHEDLPEIPDAE-PTQLEEAEHIELEKQPKPEEDQPQVPWKRGEKKQPVEE 6227
                  ::|.|:        ::|||| .:.......:..:|.|..|           .|::|.||
 Frog  2688 ------RSRSVQ--------DLPDAERDSSFMRKLSLRFKKTPPTE-----------RKQKPAEE 2727

  Fly  6228 VL---EEKKWPSGKRRPLPEQQPEEV-----QLKPIPSKPIEEQQKPEKAIPGPQLVPEEKPESE 6284
            |.   ....|..|:.....::..|.:     .::.|..|.:::|:|..::   |.|...:|..|.
 Frog  2728 VEGTGRRLSWSIGRGSSKDKKDTESLNSETGSIETITDKHLKDQKKSSQS---PVLAMRKKIGST 2789

  Fly  6285 EEELELEPLKLPEDKKPKEPKAKKEKKKKPKLKKATPSVDEVSEEVAEPFDEPIAEEDEVEEMPV 6349
            .:.|.::.....||::    .|::.:||:.:..|::|.:..:....:|.                
 Frog  2790 MDRLSMKLRSQSEDRR----DAERTEKKEGRTDKSSPLMSLLRRSNSEG---------------- 2834

  Fly  6350 DDVKVVAVSEDVLPEEEVVPTEETPEAKQKAHKKRTKRLKEASVEGQPQLLEAAIAEIEKVDEIS 6414
            :::|.:.:.::.|..:...|:.|:                                       |.
 Frog  2835 ENLKKLGIPQNQLASQVSAPSTES---------------------------------------IE 2860

  Fly  6415 QEISQKTITLLKKTEDTRPQFITTEQLIELDVEDVRRDLEMKVTSNIIKKEKRRVVLDDSQPLPE 6479
            ..:|.|:                     |:.|:|.||....:...:..||||.     .|||...
 Frog  2861 SGLSIKS---------------------EMVVKDDRRSRWDRWGLSRSKKEKM-----TSQPSIP 2899

  Fly  6480 LELITQKRIQEGIDKVADEELIEDQQLIQNQQETTTSEVIGQERKLVKKKKKEIKPPRITEKLRP 6544
            ..|            :.::..|..:|.|:|:.:.                     ||....||:.
 Frog  2900 ASL------------MHEDGSIVGRQYIRNESDF---------------------PPVFHIKLKD 2931

  Fly  6545 RQCVPEEPTVLECKVEGVPFPEIKWYFNDILLFASEKYEI-TVMEQVAKLKIAKVTPSDVGVYTC 6608
            ...:..||..|.|...|.|.|:|.|..:.:.|...||..| :..:...:|.|......:.|:|.|
 Frog  2932 IVVLEGEPVTLSCLPAGSPSPQILWKKDKMSLERGEKVHIKSCPDGRQQLIIPAAGQREAGLYEC 2996

  Fly  6609 EAKNEAGVATSRTNIILEKEQGVP-PQFTKPLKIEFIEEKQPERLKVTV-------------TCQ 6659
            .|.|..|...|...:.:.:   :| |..|..:         |::.|.||             |..
 Frog  2997 VAANALGSVASSCTVSVAR---IPDPPGTPEI---------PQKYKNTVLVLWKTHEHNSPCTYI 3049

  Fly  6660 VTGKPNPEVKWYRGIEEVIPSETVQMFY---DEKTGDVALEVI-------NPTPNEAVVYSVQAQ 6714
            :..:.|.:.:|     :|:.|.....::   :.:.|.|...|.       .|..|.:....|.|:
 Frog  3050 LEKQVNGDGEW-----KVLSSGITDCYFNVTELQEGTVRFRVACANKAGKGPYSNVSKTIVVDAE 3109

  Fly  6715 N--------QFGRAIGNA-----NILSRVDEVPR---EILKAPTVTP-------LSAVVVPTGGT 6756
            :        |..|.:|.|     .:..|....|.   .::..|.:.|       :|:.|:.|..|
 Frog  3110 DRKPGTPSVQKARPVGAAVSTTVPMTLRTPSTPAVAPPVVSTPKLPPSCGSALAVSSTVITTTAT 3174

  Fly  6757 LFFEAKYDGLPR--PEVKWMRNGREIIENEET----IIETT---ETTTTIKVVNMTRKRTGKYEV 6812
            :   :....||:  |.....|..|.|:....|    :|.||   :.|......|..........|
 Frog  3175 V---SPAQPLPKGPPPATPPRKHRGILSTPPTMHKPVIATTLSADITPQTLPNNRAPSSVAPPAV 3236

  Fly  6813 WAK-NKVGEAKSSGSVV------------------VSDQKPDEQIKPPR---------------- 6842
            .:. :.|..:.|.||.|                  ::...|..|::.|:                
 Frog  3237 CSHVSTVTVSMSPGSSVTHLRAPFSTPMQKPTPEPITKPLPVSQVQSPKAPSVPTEQTQKIALAP 3301

  Fly  6843 -----------------------FIQPLEPKYFGEHEVAIIEAIVESEPLSSFQWFVHNEPIKSS 6884
                                   :..|.||:...:.....:.|...|.|:     .:|..|.||:
 Frog  3302 AVAQVKAPFVPTTAKTNEPSRLPYSVPTEPQMPSQLAAPKLSAKSPSVPI-----MLHIPPFKSA 3361

  Fly  6885 NEVRIVSQANKSTLLIENFQSKFVGPFTCRAENVGGSVTSTATVNL-IPQEEAEEFESPRFVEEL 6948
                 ...|:..|....:|.|....|.|........:...|:.::: :|....|....|..:..:
 Frog  3362 -----TLPASSPTSKTISFPSPPTSPVTKPLTPTSPAYMVTSFISMPVPSPSVESSTPPTPLTPI 3421

  Fly  6949 VQPVEVMDGEALLLTCQVTGKPTP-----------------------------KVEWYHNAEKIT 6984
            ..|..:.....|    ..|..|||                             |...|....::|
 Frog  3422 TPPTPITPPTPL----TPTTPPTPISPTSPTAPFTPTSQTVPTRVIVRSVTPGKDARYTPGGRVT 3482

  Fly  6985 -ENKETTISQDLQGVCQLQITEVFPENEGQY----ECVATNKIGKSVSKTNVKIQAFEYIPDSEI 7044
             ..:|:|..:  |||.|...|.:..:..|::    || ..|..||     :...:..:|.|:::.
 Frog  3483 PSGRESTTLR--QGVPQKPYTFLDEKARGRFGVIREC-KENATGK-----HFMAKIIQYEPENKQ 3539

  Fly  7045 TGLTGSEEDLL-----DRTLSIDEQ--APKIIKKLPEKIEPKEGEQAKLEVKVVGKPKPKVKWLR 7102
            ..|  .|.::|     .|.||:.|.  .|:.:..:.|....:|.....:|         :.::..
 Frog  3540 NVL--QEYEILKGLHHQRILSLHEAYITPRYLVLISENCTGRELLYCLVE---------RFRYSE 3593

  Fly  7103 DDE-----QIFASEEY-------QIENFEDGTSVLVINHVYPDDLGTISFEAYN-------PLGV 7148
            ||.     ||....||       .::...:...|..:|.|...|||:    |.|       |||.
 Frog  3594 DDVVNYLLQILQGLEYLHEQKVLHLDIKPENVIVSYMNTVKIIDLGS----AQNFTPLVLRPLGK 3654

  Fly  7149 AVTTALFAVEVKFFFRCLELHYLCFPNSLESSIVG 7183
            .:.|               |.|:. |..|:...||
 Frog  3655 RIGT---------------LEYMS-PEMLKGDAVG 3673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slsNP_001261304.1 I-set 87..174 CDD:400151
Ig strand B 104..108 CDD:409353
Ig strand C 117..121 CDD:409353
Ig strand E 144..148 CDD:409353
Ig strand F 158..163 CDD:409353
I-set 255..344 CDD:400151
Ig strand B 272..276 CDD:409353
Ig strand C 285..289 CDD:409353
Ig strand E 310..314 CDD:409353
Ig strand F 324..329 CDD:409353
Ig strand G 337..340 CDD:409353
IgI_Myotilin_C_like 372..462 CDD:409405
Ig strand A 372..375 CDD:409405
Ig strand A' 378..383 CDD:409405
Ig strand B 388..395 CDD:409405
Ig strand C 402..408 CDD:409405
Ig strand C' 409..412 CDD:409405
Ig strand D 418..424 CDD:409405
Ig strand E 427..437 CDD:409405
Ig strand F 441..449 CDD:409405
Ig strand G 451..462 CDD:409405
I-set 471..560 CDD:400151
Ig strand B 488..492 CDD:409353
Ig strand C 501..505 CDD:409353
Ig strand E 527..530 CDD:409353
Ig strand F 540..545 CDD:409353
Ig strand G 553..556 CDD:409353
Ig 618..709 CDD:472250
Ig strand B 635..639 CDD:409564
Ig strand C 650..654 CDD:409564
Ig strand E 675..679 CDD:409564
Ig strand F 689..694 CDD:409564
Ig strand G 702..705 CDD:409564
Ig 751..835 CDD:472250
Ig strand B 769..775 CDD:409353
Ig strand C 784..788 CDD:409353
Ig strand E 810..816 CDD:409353
Ig strand F 823..828 CDD:409353
Ig strand G 836..839 CDD:409353
Ig 890..982 CDD:472250
Ig strand B 908..912 CDD:409353
Ig strand C 923..927 CDD:409353
Ig strand E 948..952 CDD:409353
Ig strand F 962..967 CDD:409353
Ig strand G 975..978 CDD:409353
Ig 1024..1116 CDD:472250
Ig strand B 1042..1046 CDD:409353
Ig strand C 1053..1061 CDD:409353
Ig strand E 1082..1086 CDD:409353
Ig strand F 1096..1101 CDD:409353
Ig strand G 1109..1112 CDD:409353
Ig 1158..1250 CDD:472250
Ig strand B 1176..1180 CDD:409353
Ig strand C 1191..1195 CDD:409353
Ig strand E 1216..1220 CDD:409353
Ig strand F 1230..1235 CDD:409353
Ig strand G 1243..1246 CDD:409353
Ig 1291..1380 CDD:472250
Ig strand B 1308..1312 CDD:409564
Ig strand C 1323..1327 CDD:409564
Ig strand E 1348..1352 CDD:409564
Ig strand F 1362..1367 CDD:409564
Ig strand G 1375..1378 CDD:409564
Ig 1424..1515 CDD:472250
Ig strand B 1442..1446 CDD:409353
Ig strand C 1457..1461 CDD:409353
Ig strand E 1482..1486 CDD:409353
Ig strand F 1496..1501 CDD:409353
I-set 1558..1645 CDD:400151
Ig strand B 1575..1579 CDD:409353
Ig strand C 1590..1594 CDD:409353
Ig strand E 1615..1619 CDD:409353
Ig strand F 1629..1634 CDD:409353
Ig strand G 1643..1646 CDD:409353
I-set 1691..1782 CDD:400151
Ig strand B 1708..1712 CDD:409353
Ig strand C 1721..1727 CDD:409353
Ig strand E 1748..1752 CDD:409353
Ig strand F 1762..1767 CDD:409353
Ig strand G 1775..1778 CDD:409353
I-set 1824..1916 CDD:400151
Ig strand B 1842..1846 CDD:409353
Ig strand C 1857..1861 CDD:409353
Ig strand E 1882..1886 CDD:409353
Ig strand F 1896..1901 CDD:409353
Ig strand G 1909..1912 CDD:409353
Ig 1958..2049 CDD:472250
Ig strand B 1975..1979 CDD:409564
Ig strand C 1990..1994 CDD:409564
Ig strand E 2015..2019 CDD:409564
Ig strand F 2029..2034 CDD:409564
Ig strand G 2042..2045 CDD:409564
Ig 2089..2181 CDD:472250
Ig strand B 2107..2111 CDD:409353
Ig strand C 2122..2126 CDD:409353
Ig strand E 2144..2151 CDD:409353
Ig strand F 2161..2166 CDD:409353
Ig strand G 2174..2177 CDD:409353
Ig 2222..2314 CDD:472250
Ig strand B 2240..2244 CDD:409353
Ig strand C 2253..2259 CDD:409353
Ig strand E 2280..2284 CDD:409353
Ig strand F 2294..2299 CDD:409353
Ig strand G 2307..2310 CDD:409353
Ig 2356..2448 CDD:472250
Ig strand C 2389..2393 CDD:409353
Ig strand E 2414..2418 CDD:409353
Ig strand F 2428..2433 CDD:409353
Ig 2516..2577 CDD:409353
Ig strand C 2521..2525 CDD:409353
Ig strand E 2546..2550 CDD:409353
Ig strand F 2560..2565 CDD:409353
Ig strand G 2574..2577 CDD:409353
I-set 2622..2714 CDD:400151
Ig strand C 2655..2659 CDD:409353
Ig strand E 2680..2684 CDD:409353
Ig strand F 2694..2699 CDD:409353
I-set 2754..2844 CDD:400151
Ig strand B 2771..2775 CDD:409353
Ig strand C 2786..2790 CDD:409353
Ig strand E 2811..2815 CDD:409353
Ig strand F 2825..2830 CDD:409353
Ig strand G 2838..2841 CDD:409353
Ig 2905..2981 CDD:472250
Ig strand C 2925..2929 CDD:409353
Ig strand E 2950..2954 CDD:409353
Ig strand F 2964..2969 CDD:409353
Ig strand G 2978..2981 CDD:409353
Ig 3029..3120 CDD:472250 22/93 (24%)
Ig strand C 3062..3066 CDD:409353 0/3 (0%)
Ig strand E 3087..3091 CDD:409353 0/3 (0%)
Ig strand F 3101..3106 CDD:409353 3/4 (75%)
Ig 3130..3220 CDD:472250 22/139 (16%)
Ig strand B 3148..3152 CDD:409353 0/11 (0%)
Ig strand C 3163..3167 CDD:409353 1/21 (5%)
Ig strand E 3188..3192 CDD:409353 1/3 (33%)
Ig strand F 3202..3207 CDD:409353 1/4 (25%)
Ig strand G 3216..3219 CDD:409353 1/11 (9%)
Ig 3263..3354 CDD:472250 24/122 (20%)
Ig strand C 3296..3300 CDD:409353 1/3 (33%)
Ig strand E 3321..3325 CDD:409353 1/3 (33%)
Ig strand F 3335..3340 CDD:409353 1/4 (25%)
I-set 3401..3493 CDD:400151 24/113 (21%)
Ig strand C 3434..3438 CDD:409353 3/13 (23%)
Ig strand E 3459..3463 CDD:409353 0/3 (0%)
Ig strand F 3473..3478 CDD:409353 1/4 (25%)
Ig strand G 3487..3490 CDD:409353 0/2 (0%)
I-set 3539..3630 CDD:400151 15/90 (17%)
Ig strand B 3556..3560 CDD:409353 0/3 (0%)
Ig strand C 3571..3575 CDD:409353 0/3 (0%)
Ig strand E 3596..3600 CDD:409353 0/3 (0%)
Ig strand F 3610..3615 CDD:409353 1/4 (25%)
Ig strand G 3623..3626 CDD:409353 0/2 (0%)
Ig 3676..3767 CDD:472250 25/91 (27%)
Ig strand B 3694..3698 CDD:409353 0/3 (0%)
Ig strand C 3709..3713 CDD:409353 0/3 (0%)
Ig strand E 3734..3738 CDD:409353 1/3 (33%)
Ig strand F 3748..3753 CDD:409353 2/4 (50%)
Ig strand G 3761..3764 CDD:409353 0/2 (0%)
I-set 3811..3900 CDD:400151 27/90 (30%)
Ig strand B 3828..3832 CDD:409353 0/3 (0%)
Ig strand C 3841..3847 CDD:409353 0/5 (0%)
Ig strand E 3868..3872 CDD:409353 2/3 (67%)
Ig strand F 3882..3887 CDD:409353 2/4 (50%)
Ig strand G 3896..3899 CDD:409353 0/2 (0%)
Ig 3954..4046 CDD:472250 24/98 (24%)
Ig strand B 3972..3976 CDD:409353 1/3 (33%)
Ig strand C 3987..3991 CDD:409353 1/3 (33%)
Ig strand E 4009..4013 CDD:409353 0/3 (0%)
Ig strand F 4026..4031 CDD:409353 2/4 (50%)
Ig strand G 4039..4042 CDD:409353 1/2 (50%)
Ig 4092..4180 CDD:472250 27/88 (31%)
Ig strand B 4109..4113 CDD:409353 2/3 (67%)
Ig strand C 4122..4126 CDD:409353 1/3 (33%)
Ig strand E 4146..4150 CDD:409353 2/4 (50%)
Ig strand F 4160..4165 CDD:409353 0/4 (0%)
Ig strand G 4173..4176 CDD:409353 0/2 (0%)
Ig 4394..4484 CDD:472250 25/89 (28%)
Ig strand B 4411..4415 CDD:409353 0/3 (0%)
Ig strand C 4424..4428 CDD:409353 1/3 (33%)
Ig strand E 4449..4453 CDD:409353 1/3 (33%)
Ig strand F 4463..4468 CDD:409353 1/4 (25%)
Ig strand G 4476..4479 CDD:409353 1/2 (50%)
I-set 4497..4581 CDD:400151 12/83 (14%)
Ig strand B 4514..4518 CDD:409564 0/3 (0%)
Ig strand C 4527..4531 CDD:409564 0/3 (0%)
Ig strand E 4552..4556 CDD:409564 0/3 (0%)
Ig strand F 4566..4571 CDD:409564 0/4 (0%)
I-set 4604..4693 CDD:400151 16/100 (16%)
Ig strand B 4621..4625 CDD:409564 0/3 (0%)
Ig strand C 4634..4638 CDD:409564 1/10 (10%)
Ig strand E 4659..4663 CDD:409564 1/3 (33%)
Ig strand F 4673..4678 CDD:409564 0/4 (0%)
Ig strand G 4686..4689 CDD:409564 0/2 (0%)
Ig 4702..4792 CDD:472250 24/89 (27%)
Ig strand B 4719..4723 CDD:409564 2/3 (67%)
Ig strand C 4733..4737 CDD:409564 0/3 (0%)
Ig strand E 4758..4762 CDD:409564 1/3 (33%)
Ig strand F 4772..4777 CDD:409564 1/4 (25%)
Ig strand G 4785..4788 CDD:409564 0/2 (0%)
rne <5284..5662 CDD:236766 71/394 (18%)
PTZ00121 <5931..6415 CDD:173412 94/524 (18%)
I-set 6536..6622 CDD:400151 25/86 (29%)
Ig strand B 6553..6557 CDD:409353 1/3 (33%)
Ig strand C 6566..6570 CDD:409353 1/3 (33%)
Ig strand E 6591..6595 CDD:409353 1/3 (33%)
Ig strand F 6605..6610 CDD:409353 2/4 (50%)
Ig strand G 6618..6621 CDD:409353 1/2 (50%)
Ig 6633..6727 CDD:472250 22/129 (17%)
Ig strand B 6650..6654 CDD:409353 0/3 (0%)
Ig strand C 6667..6671 CDD:409353 0/3 (0%)
Ig strand E 6694..6698 CDD:409353 1/3 (33%)
Ig strand F 6708..6713 CDD:409353 1/4 (25%)
Ig strand G 6721..6724 CDD:409353 1/2 (50%)
Ig 6741..6829 CDD:472250 24/122 (20%)
Ig strand B 6757..6761 CDD:409353 0/3 (0%)
Ig strand C 6770..6774 CDD:409353 0/3 (0%)
Ig strand F 6809..6814 CDD:409353 1/4 (25%)
Ig strand G 6822..6825 CDD:409353 1/2 (50%)
Ig 6841..6928 CDD:472250 18/125 (14%)
Ig strand B 6858..6862 CDD:409564 0/3 (0%)
Ig strand C 6871..6875 CDD:409564 0/3 (0%)
Ig strand E 6896..6900 CDD:409564 1/3 (33%)
Ig strand F 6910..6915 CDD:409564 2/4 (50%)
Ig strand G 6923..6926 CDD:409564 0/2 (0%)
I-set 6942..7033 CDD:400151 23/124 (19%)
Ig strand B 6960..6964 CDD:409353 1/3 (33%)
Ig strand C 6973..6977 CDD:409353 1/3 (33%)
Ig strand E 6999..7003 CDD:409353 1/3 (33%)
Ig strand F 7013..7018 CDD:409353 2/8 (25%)
Ig strand G 7026..7029 CDD:409353 0/2 (0%)
Ig 7066..7157 CDD:472250 22/109 (20%)
Ig strand B 7084..7088 CDD:409353 0/3 (0%)
Ig strand C 7097..7101 CDD:409353 0/3 (0%)
Ig strand E 7123..7127 CDD:409353 1/3 (33%)
Ig strand F 7137..7142 CDD:409353 0/4 (0%)
Ig strand G 7150..7153 CDD:409353 0/2 (0%)
Ig 7210..7289 CDD:472250
Ig strand B 7227..7231 CDD:409353
Ig strand C 7240..7244 CDD:409353
Ig strand E 7265..7269 CDD:409353
Ig strand F 7279..7284 CDD:409353
Ig strand G 7292..7295 CDD:409353
PTZ00121 <9687..10410 CDD:173412
PTZ00121 <10681..11475 CDD:173412
PTZ00121 <15007..15806 CDD:173412
rne <15728..15918 CDD:236766
SH3_p47phox_like 16753..16807 CDD:212790
I-set 16841..16931 CDD:400151
Ig strand B 16858..16862 CDD:409564
Ig strand C 16871..16875 CDD:409564
Ig strand E 16897..16901 CDD:409564
Ig strand F 16911..16916 CDD:409564
Ig strand G 16924..16927 CDD:409564
Ig_3 16964..17047 CDD:464046
I-set 17068..17152 CDD:400151
Ig strand B 17085..17089 CDD:409564
Ig strand C 17098..17102 CDD:409564
Ig strand E 17118..17122 CDD:409564
Ig strand F 17132..17137 CDD:409564
Ig strand G 17145..17148 CDD:409564
I-set 17176..17253 CDD:400151
Ig strand B 17180..17184 CDD:409564
Ig strand C 17193..17197 CDD:409564
Ig strand E 17218..17222 CDD:409564
Ig strand F 17233..17238 CDD:409564
Ig strand G 17246..17249 CDD:409564
Ig 17260..17342 CDD:472250
Ig strand B 17276..17280 CDD:409353
Ig strand C 17287..17291 CDD:409353
Ig strand E 17312..17316 CDD:409353
Ig strand F 17326..17331 CDD:409353
Ig 17347..17432 CDD:472250
Ig strand B 17364..17368 CDD:409353
Ig strand C 17376..17380 CDD:409353
Ig strand E 17402..17406 CDD:409353
Ig strand F 17416..17421 CDD:409353
Ig strand G 17425..17428 CDD:409353
Ig 17437..17521 CDD:472250
Ig strand B 17454..17458 CDD:409353
Ig strand C 17466..17470 CDD:409353
Ig strand E 17491..17495 CDD:409353
Ig strand F 17505..17510 CDD:409353
Ig strand G 17514..17517 CDD:409353
Ig 17538..17611 CDD:472250
Ig strand B 17544..17548 CDD:409353
Ig strand C 17556..17560 CDD:409353
Ig strand E 17581..17585 CDD:409353
Ig strand F 17595..17600 CDD:409353
Ig strand G 17604..17607 CDD:409353
Ig 17618..17708 CDD:472250
Ig strand B 17636..17640 CDD:409353
Ig strand C 17649..17653 CDD:409353
Ig strand E 17674..17678 CDD:409353
Ig strand F 17688..17693 CDD:409353
Ig strand G 17701..17704 CDD:409353
FN3 17712..17791 CDD:238020
Ig 17813..17898 CDD:472250
Ig strand B 17830..17834 CDD:409353
Ig strand C 17843..17847 CDD:409353
Ig strand E 17862..17869 CDD:409353
Ig strand F 17879..17884 CDD:409353
Ig 17917..17994 CDD:472250
Ig strand B 17922..17926 CDD:409353
Ig strand C 17935..17939 CDD:409353
Ig strand E 17960..17964 CDD:409353
Ig strand F 17974..17979 CDD:409353
Ig strand G 17987..17990 CDD:409353
FN3 17998..18090 CDD:238020
FN3 <18068..18364 CDD:442628
spegXP_031748703.1 I-set 50..132 CDD:400151 22/91 (24%)
Ig strand B 67..71 CDD:409353 0/3 (0%)
Ig strand C 80..84 CDD:409353 0/3 (0%)
Ig strand E 99..102 CDD:409353 1/2 (50%)
Ig strand F 112..117 CDD:409353 3/4 (75%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
I-set 765..854 CDD:400151 25/92 (27%)
Ig strand B 782..786 CDD:409353 0/3 (0%)
Ig strand C 795..799 CDD:409353 1/4 (25%)
Ig strand E 820..824 CDD:409353 1/3 (33%)
Ig strand F 834..839 CDD:409353 2/4 (50%)
Ig strand G 847..850 CDD:409353 0/2 (0%)
Ig 910..1000 CDD:472250 29/98 (30%)
Ig strand B 927..931 CDD:409353 0/3 (0%)
Ig strand C 940..944 CDD:409353 0/5 (0%)
Ig strand E 966..970 CDD:409353 2/3 (67%)
Ig strand F 980..985 CDD:409353 2/4 (50%)
Ig strand G 993..996 CDD:409353 1/2 (50%)
Ig 1014..1099 CDD:472250 25/140 (18%)
Ig strand B 1026..1030 CDD:409353 3/5 (60%)
Ig strand C 1039..1043 CDD:409353 1/3 (33%)
Ig strand E 1065..1069 CDD:409353 0/3 (0%)
Ig strand F 1079..1084 CDD:409353 2/4 (50%)
Ig strand G 1092..1095 CDD:409353 0/2 (0%)
Ig 1105..1194 CDD:472250 27/88 (31%)
Ig strand B 1122..1126 CDD:409353 2/3 (67%)
Ig strand C 1135..1139 CDD:409353 1/3 (33%)
Ig strand E 1160..1164 CDD:409353 2/3 (67%)
Ig strand F 1174..1179 CDD:409353 0/4 (0%)
Ig strand G 1187..1190 CDD:409353 0/2 (0%)
I-set 1231..1320 CDD:400151 26/149 (17%)
Ig strand B 1248..1252 CDD:409353 0/3 (0%)
Ig strand C 1261..1265 CDD:409353 1/3 (33%)
Ig strand E 1286..1290 CDD:409353 1/3 (33%)
Ig strand F 1300..1305 CDD:409353 1/4 (25%)
Ig strand G 1313..1316 CDD:409353 1/2 (50%)
I-set 1527..1616 CDD:400151 24/89 (27%)
Ig strand B 1544..1548 CDD:409353 2/3 (67%)
Ig strand C 1557..1561 CDD:409353 0/3 (0%)
Ig strand E 1582..1586 CDD:409353 1/3 (33%)
Ig strand F 1596..1601 CDD:409353 1/4 (25%)
Ig strand G 1609..1612 CDD:409353 0/2 (0%)
Protein Kinases, catalytic domain 1639..1894 CDD:473864 48/317 (15%)
I-set 2923..3013 CDD:400151 25/89 (28%)
Ig strand B 2940..2944 CDD:409353 1/3 (33%)
Ig strand C 2953..2957 CDD:409353 1/3 (33%)
Ig strand E 2979..2983 CDD:409353 1/3 (33%)
Ig strand F 2993..2998 CDD:409353 2/4 (50%)
PHA03247 <3106..3499 CDD:223021 70/411 (17%)
Protein Kinases, catalytic domain 3496..3752 CDD:473864 45/215 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.