DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sls and hmcn1

DIOPT Version :9

Sequence 1:NP_001261304.1 Gene:sls / 44013 FlyBaseID:FBgn0086906 Length:18468 Species:Drosophila melanogaster
Sequence 2:XP_012816895.2 Gene:hmcn1 / 100135378 XenbaseID:XB-GENE-6258572 Length:5519 Species:Xenopus tropicalis


Alignment Length:5489 Identity:1118/5489 - (20%)
Similarity:1745/5489 - (31%) Gaps:1882/5489 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 VTWTRKGAPLLESQKFRMSYNEATGDVSLLINQIGPGDEGEYTCTARNQYGEAICSVYIQPEGAP 182
            |.:::.|..|...||||.|.|     .|..|..:...|||.|.|.|.:..|.|            
 Frog   462 VRFSKNGVKLGTDQKFRESVN-----ASWEIANVSVSDEGYYDCYASSSAGNA------------ 509

  Fly   183 MPALQPIQNLEKNIYSNGYSYTSIEEEFRVDTFEYRLLREVSFREAITRRSGYEQDSQLSQELDR 247
                                        |..||                             ||.
 Frog   510 ----------------------------RAQTF-----------------------------LDV 517

  Fly   248 NQGPAQAPQISQKPRSSKLIEGSDAVFTARVGSNPKPRLTWFHNGQRLVASQKYEISYSSGVATL 312
            |    :.|.:.:.|.:..:..|..|:.|..|.|..:..|||..|...|......::|.... .:|
 Frog   518 N----EPPPVIKAPSNITVTVGKGAILTCDVVSTVRFNLTWLRNNLDLKHMNPSKLSILRN-NSL 577

  Fly   313 RVKNATARDGGHYTLLAENLQGCVVSSAVLAVEPAAETAYEPKPVDVMAEQLEAGKALPPAFVKA 377
            .:|:.|..|||.|...|.|..|...:|..|..:...:...||:.|                    
 Frog   578 EIKSVTIDDGGEYNCFASNEGGTATASVTLIAQDPPKAVLEPRNV-------------------- 622

  Fly   378 FGDREITEGRMTRFDCRVTGNPYPEVFWLINGRQVRDDASHKILVNESGSHSLMITNVTRLDAGA 442
                ..|:|...:..|.|||.|.|.:.|:.|...||  .|::.::..:|  :.:|.|....|:|.
 Frog   623 ----TFTKGAEIKLKCLVTGYPTPHIIWMHNDMFVR--FSNRYIITHNG--TFIIKNAVERDSGV 679

  Fly   443 VQCLARNKAGEVAIEAQLNVLEKEQVVAPQFVQRFSTMTVREGEPITMSANAIGTPQPRITWQKD 507
            .:|||.|.||   .:.|.:|:...:|  ||.....:.|.|..|...|::..|.|.|:|.|.|.|:
 Frog   680 YKCLATNAAG---TDHQTSVMVYIEV--PQVTAVKNEMLVPVGSETTLACKATGIPRPLIYWYKE 739

  Fly   508 GVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARL-------YVEVPRE 565
            .:::|.:|  .:.||.....|:|.....:|||.|.|.|.|.||....:..|       :.:.|.:
 Frog   740 NIKLSPSA--LITIDSLLGTLKIKNTQFSDAGHYVCIAVNDAGKANGKVSLRVGSPPVFTQTPGD 802

  Fly   566 -------------------QPNYEQRRLN------------------------------------ 575
                               :|..:.||||                                    
 Frog   803 VSMDIGSDVSLTCSAEGIPEPKIKWRRLNHTSESSKPLSYQYNSQQKAGTLQINKLWVGDEGIYI 867

  Fly   576 ----------------------------LPRPTKVIEPEPI----------PGPEIIYLR----- 597
                                        .|....|||...:          |.||..:::     
 Frog   868 CEAENQFGKISSQATITVTGLVVPVIGESPSVVSVIEGNQVTLPCVLLVGNPLPERHWVKDNVVL 932

  Fly   598 --------------HVERAKPHLRPGEE------------DRVYPPPQFIIPL-----QNVQQTE 631
                          |:||..  |:.|.:            ||:......:.|:     |.....|
 Frog   933 VTNPYTSIRADGSLHLERVL--LKDGGDYLCTAKNVAGTADRITTINVHVSPVIQHGPQIFSTIE 995

  Fly   632 GGRVHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTN 696
            |..|.:..:...|..||::  |...|..:..:.........|.:.|.  |..|.|||||.|...|
 Frog   996 GIAVSLPCKASGVPKPTII--WKKKGEIVVPNNDTIIAESDGTLLLS--SPGGEDSGEYSCSAIN 1056

  Fly   697 ASGVAESRAILSVVQRPSIEQSSQNPNSLQYINQLEDYSRYQRTESIDEQLNQAPQFIRPLRDLG 761
            |:|.|..:..|:|..:|.|.....|.:|:...||:|...|                         
 Frog  1057 AAGYAARKVQLTVYVKPRIVSPDANGSSIAQKNQIEISVR------------------------- 1096

  Fly   762 EFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVSLNILHLRAEDAGTYTV 826
               .|.:|....:|..|..|.  :.|.|:...|:..|:..:||..|  ||.|...|..|||.||.
 Frog  1097 ---AGDDVILPCEVKSVPPPF--ITWAKETQLISPFSQRHSIFPSG--SLKIFETRVSDAGMYTC 1154

  Fly   827 RAVNRIGEAISQSSIRVHSRSQVTADLGIPEQQRYIEKVEELEDYRKSQQRRHVQEAAEAIAPPQ 891
            ...|..|.......:.|:..         |:.||                           .|..
 Frog  1155 VGTNIAGNITQLVKLSVYVP---------PKIQR---------------------------GPKL 1183

  Fly   892 FKTPIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLT 956
            .:..:.:..::...:|          |.......|.||||.:|...  ...:|.    |.::...
 Frog  1184 IRVKLGHSFEIACISH----------GIPPPTAAWYKDGQIMEFDQ--GQDNNM----LRVESAK 1232

  Fly   957 IYDAGTYTCRAYNAMGQDTTVAQLTVISKNEIVSESQHPGGLQKIQHLEDSSRYGRREEEETYIT 1021
            ..|.|||||.|.|.:|.|:..|.:.:.:. ..:|:.:.|              | .::.:|....
 Frog  1233 PSDGGTYTCVASNVIGTDSANATVEIYAP-PTLSDLEPP--------------Y-NKQNQERISR 1281

  Fly  1022 QAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGLVIEWYHNGRSITAAN-RIQTYYDFGYVALD 1085
            |...|..|:||..|              |      ||:|:.||:.:|.:. .:....|...:.:|
 Frog  1282 QQISFPCPVKGHPK--------------P------VIKWFRNGKELTGSEPGVNIVEDRAVLVID 1326

  Fly  1086 ISQVRAEDAGVYLVVARNKLGEAQQQATMIVETRSSIDTSSMHRGLYEKTQNLENKPFVEPQYDI 1150
              .:...|.|.|..||.|:.|:.:::.::                      .:.:.|.::   |:
 Frog  1327 --SLTPYDNGEYTCVASNEAGQTEKKYSL----------------------KVHDPPLIK---DM 1364

  Fly  1151 EEISKSKPVFVTPLSDPKPIHDGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGF 1215
            :.||.     |:.|     :|  :.:.|.|  |..|.|...:.|: .||.....|......:.|.
 Frog  1365 DIISN-----VSVL-----LH--QTMSLLC--EASGSPPPLITWY-KGRTQVDESATVQILEKGK 1414

  Fly  1216 VALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTDVV----------------------- 1257
            : |.|:|....|||.||.:|.|..|.:.....|.|:|...:.                       
 Frog  1415 I-LKILKMALKDSGHYTCKANNIAGESKKQYFVNVLDPPTIAGVGTISDVSVIAGREVNLECKVK 1478

  Fly  1258 -----------------TETQNEQSLEQIQLLEDSRRR-----------------HHQEEDITIM 1288
                             ||..|...||..|:|.....|                 ..:|..:|:.
 Frog  1479 GIPFPSIQWFKENRLLSTEDPNVVMLENGQVLHIKHSRLSDSGKYKCIAANTAGSQTKEIKLTVY 1543

  Fly  1289 QAPQFTRGLHNIE---TIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVA- 1349
            .||....|....:   |:.| .::|||..:  |.|...|.|:.:|:|:      .|:....|:. 
 Frog  1544 IAPTIKDGNSTTDLSFTVNG-EINLECDAR--GIPPPTIIWYKDGEPL------LPSPYVTYIQK 1599

  Fly  1350 ---LDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDLILETQNESGLQKIQYLEDSTRHR 1411
               |.:......|.|.|||...|..|:...:.||      |:.:..:...         |..:|:
 Frog  1600 GKYLRITESQITDGGTYTCSVTNVAGQTEKNYSV------DIYVPARIHG---------DEKKHQ 1649

  Fly  1412 RSEFVDEVVNIRPRFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPI 1476
            ..:.:            ..||||         .||  |....|...:.|.|:|.|:......| :
 Frog  1650 NKKVI------------VGKSLT---------LEC--EATGHPPPLITWLKDGVPVETNDNIR-L 1690

  Fly  1477 HDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQ---------------------------VEL 1514
            | :....|:|.:.:..|.|:|||.|||:.|..|.:                           |||
 Frog  1691 H-YNGKKLEIRNTVEYDRGLYTCVAVNVAGETEMKYKVSVLVPPSIEGGNDPADHTVIASGAVEL 1754

  Fly  1515 QC-RSGEQIVTVTQNEAGL-----------EQIHYL-------EDRSRY--TRREEIDESTKQ-- 1556
            :| .||..:.:|...:.|.           ...|.|       .|...|  ..:.|...||||  
 Frog  1755 ECLASGTPLPSVMWLKNGTPVDTSGRLIIQSNGHKLLISSTESSDSGNYQCVVKNEAGSSTKQFN 1819

  Fly  1557 -----APVFTTSLKNVEIKENQRAHFECRLIPVSDPSMRVEWYHNNLPLKSGSRFTETNNFGFVA 1616
                 .|........|.|..::....:|  |....|:..:.|..:.||........:..:|| .:
 Frog  1820 VVVHVRPTIKPVASPVSILMHKATTLQC--IASGIPNPHITWLKDGLPFNVAKANIKMESFG-RS 1881

  Fly  1617 LDIMSTLPEDAGTYTCRAYNAVGEAITSAVAVVHTKKSIYL------------ESQHETAL---- 1665
            |....||.||||.|||.|.||.|||          :::|:|            |...||.|    
 Frog  1882 LQFKKTLLEDAGKYTCVATNAAGEA----------EQTIWLNVYEPPKIENSGELIQETVLANHN 1936

  Fly  1666 ------------PRLQHLEDGSKRQR---ISVQDE----FVSQAPVF------------------ 1693
                        |.:...:|..:...   |||.|.    .:|.|.||                  
 Frog  1937 IILECKATGNPDPVVTWFKDNQQLTNTGDISVSDRGQVLQISGAQVFHAGTYKCVAASIAGRAEL 2001

  Fly  1694 --TMPVR----------DVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEA-SNRTTTMHDF 1745
              .:.|.          .:.|..|..|..|........|.||  ||::|.|:.: :|....:...
 Frog  2002 SYNLQVHVPPSISGRSSSITVIVNNVVRLECEATGFPAPSLT--WLKDGSPVSSFTNGIQILSGG 2064

  Fly  1746 GYVALNMKYVNPEDSGTYTCRAVNELGQAVTSASLIVQSKTSIQLETQHEAAMHKIHQLEDHSRY 1810
            ..:||....|.  |:|.|||.|||..|:..|...|.|....:|..|.|:                
 Frog  2065 RVLALTNAQVG--DAGKYTCVAVNAAGEQQTDYDLSVYVPPNIMGEEQN---------------- 2111

  Fly  1811 QRREEEEYTVTTAPVFVTKLIGPSNLVEGQSAHYECRIEPYPDPNLKVEWFHNGKPLSTGHRFRT 1875
                            ::.||..:.::       :|..:..|.|.|  .|:.:.|||.  :|...
 Frog  2112 ----------------ISSLISETLIL-------KCESDAIPPPVL--TWYKDWKPLV--NRPGL 2149

  Fly  1876 TYDFGFAALDILTVYAEDSGEYTCRVTNNLGEAINSIVLNVTSRSSIIHETQHEEALTKIQHLED 1940
            |.....:.|.|.....:|:|.|:|...|..|:...:..:|:....:|                  
 Frog  2150 TISEDGSILKIEGAQVKDTGRYSCEAVNIAGKTEKNFNVNIMVPPAI------------------ 2196

  Fly  1941 TSRFQRKTDEEQFHAERPQFGRPLRNAKVN--EGAPVHL--EATLIPVNDPTMKVEWYCNGRPIQ 2001
                 |.:.||               ::||  ||..:.|  ::|.||  .|.:  .|..|...||
 Frog  2197 -----RGSAEE---------------SEVNIIEGTLISLLCDSTGIP--PPAL--AWKKNDVAIQ 2237

  Fly  2002 TGHRFKTTYDFGFVALDILYAHAEDTGTYMCKAKNAIGEAVTTCAVNVTANKTLDLDTLDAQRLE 2066
            :|.........|...|.|:.|...|..:|.|.|.|::|.|:....|.|..               
 Frog  2238 SGAAGHIRLLSGGRQLQIITARKSDAASYTCTASNSVGSAMKKYTVKVYV--------------- 2287

  Fly  2067 KIRQLETYAPPPKPVVEEKGQKPIFLTPLSNLEHLKEGEHAHLECRVEPINDPNLKIEWFCNGKQ 2131
                        :|.:.|.|..|..:..:       :|.:..|||  :...||...:.|...|..
 Frog  2288 ------------RPSISESGNHPSEIVVI-------QGNNVTLEC--DARGDPQPMLTWLKEGIP 2331

  Fly  2132 LPTGHRYRTTHDFGYVALDILYVYGEDTGTYICKATNQLGEAVNTCNVRVLNRRSMILDTQHPDA 2196
            |.:|:.:..:.:...:.|....:  .:.|.|:|.|.|..|::....:::|      .:....||.
 Frog  2332 LISGNGFEISSNGRLLHLQKAQI--SNAGLYVCVAVNVAGQSDRKYDLKV------FVPPAFPDG 2388

  Fly  2197 LEKIQKLESKVPNARTEVGDAPISPPHFTAELRGSTEIYEGQTAHFEAQVAPVHDPNLRIEFYHN 2261
            :.|.:.:.....|           |...|.|:.|.                    |..::.:|.:
 Frog  2389 IMKHENISIVEKN-----------PFTLTCEVSGI--------------------PPPKVTWYKD 2422

  Fly  2262 GKPLPSASRFHITFDFGYVSLDITHAVAEDAGEYSVRAVNALGQAVSSTNLRVIPRGTIISDTQH 2326
            |.|:| .||.......|:: |..:.:...|.|.|:....||.|:.:...::.|:           
 Frog  2423 GNPIP-PSRSPQIMSGGFL-LRFSQSSLSDTGRYTCAVSNAAGEDMRKFDVNVL----------- 2474

  Fly  2327 PEGLEKIRKLESTAPHQRQEPETPGTRQRPVFTQPLQNIDRINEHQTAHFEARLIPVGDPNLKVE 2391
                         .|     |:..|:.|..:..:...||       |...||    .|.|..::.
 Frog  2475 -------------VP-----PKITGSVQEEIKVKERGNI-------TLSCEA----TGTPIPQIT 2510

  Fly  2392 WYRN-EKIIEDSS-RITKQHDFGFVSLDISHIRKEDEGVYMCRAVNPLGEAVTTASM-------- 2446
            |.:: ..::||:: ||..:...    |.||::...|.|.|:|.|.||.||...:.|:        
 Frog  2511 WLKDGHPVLEDTNHRIDHKRQL----LRISNVMMTDSGRYVCVASNPAGERSRSFSLGVLISPTI 2571

  Fly  2447 -----------RVVSEASIQMDTQ---HPDSISRIHQLEKPLAPRPTEPERLFEKPIFTQLLTG- 2496
                       :||..:||.::.:   ||.:....|           :..|||:.....::|.| 
 Frog  2572 KGAINGSPEDVKVVLLSSISLECEVHSHPPATITWH-----------KDGRLFKFKDNVRILPGG 2625

  Fly  2497 --------------------PSELWEGTHAHFEARV-VP-------------------------- 2514
                                .:|..|||| |:...| :|                          
 Frog  2626 RTLQILKAQEKDAGRYSCIATNEAGEGTH-HYNLNVHIPPKIRKDDISEFGGFSKEIKAIVNTNF 2689

  Fly  2515 ------VGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAGEAV 2573
                  ..:|..|..|:.:|..|:..|.|.....   .||.:......|.|.|.|.|.|.|||  
 Frog  2690 TLVCDVKANPLAKITWYKDGQPLEPDSHLAIVSG---NTLYVEKAQVSDTGRYTCLASNIAGE-- 2749

  Fly  2574 SSTAMKVKTKSNIDGQPLIPESWEAIRLKEAAMNRVPEMFVDSTPQQAPVFTTHLQSYDKLHEGQ 2638
                      ..:|....|               :||..|    |:.:.::||...|... ..|:
 Frog  2750 ----------DELDFDVTI---------------QVPPNF----PKLSGLWTTSKSSTGS-SNGE 2784

  Fly  2639 H--VLL----EAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDF-GLVTLSINGLRADDSAIYT 2696
            |  |::    ....|..|.|...|.|:|:...||..:|   .|.. |...|.|...:.||:..||
 Frog  2785 HKEVIINNPFSLYCETNAVPPPTITWYKDDKLLTPSNR---AFILPGGHILQIARAQEDDAGTYT 2846

  Fly  2697 CKATNQVGEAVSTSSLKIEDRHWLQAESLHPDSLPRIGELEAPK-EGRPEAPEPTYETPVFITHL 2760
            |.|.|:.|.                 :|:|.:    :..|..|. ||..|      :....||.|
 Frog  2847 CVAVNEAGR-----------------DSMHYN----VRVLLPPAFEGSDE------DLSKDITSL 2884

  Fly  2761 NNIECKESDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYCALDLTNS------Y 2819
            .|      :.:..:|.|.....|..:|.|..:|.|:|...:    |.|      |||.      |
 Frog  2885 VN------ETLEMDCTVAVTGSPAPTISWLKDGHPIQEGTR----YHF------LTNGRTLKILY 2933

  Fly  2820 AE--NSGVYTCKATNSKGSATTSGTLKCTGGKTMFLDTQHPQGEAGLEAVQETEEELANRYTSKT 2882
            |:  ::|.|.|...|..||..          |:..|:...|....|..:...|..|  :.:.|.|
 Frog  2934 AQLMDTGRYVCVVENPAGSVQ----------KSFNLNIYVPPSVIGSNSENVTVVE--SNFISLT 2986

  Fly  2883 TKPETQYPPPVWTKPLQAEFHLSEAQPIHLEANVEPKEDPNLFIEWYFNGKMLNHGSRFKMTSEF 2947
            .: .|.:|||.                                :.|..:..:||..|...:..  
 Frog  2987 CE-VTGFPPPA--------------------------------VSWLKDTMVLNSDSHLFIVP-- 3016

  Fly  2948 GFVTMDMIEVYARDQGIYTCKAYNKAGEAFTSTTIFCSSKENIIESTQHPKGAEGLEQIQDLEDS 3012
            |..|:.:.:....|.|.|:|.|.|:||||  ..|.|.                            
 Frog  3017 GGRTLQIPQTRLSDVGEYSCIAINQAGEA--KKTFFL---------------------------- 3051

  Fly  3013 LRKDGSKPEQPDLGIPP------RFTTEFVNIADIGEGELAHFEANLIPVGDQSMVIEWFYNGKV 3071
                       |:..||      |.::..||: .:....:...|:|.||    :.||.|:.||:.
 Frog  3052 -----------DIYAPPSIVANVRDSSTEVNV-KVNASTILECESNAIP----APVINWYKNGQP 3100

  Fly  3072 LEASHRVRTIYAF--GTVALEVLGTKIEDTGTYTCRATNKHGTAEISCNLECVDKPRGQKPRFTS 3134
            :    |..:.|.|  |...|.:...::.|||.|.|..||..|              :..|..|.:
 Frog  3101 I----RETSSYQFLEGGQRLNIRNAQVFDTGEYECIVTNVVG--------------QDNKKFFLN 3147

  Fly  3135 -HIQP-LEGLKD-------GQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVL 3190
             ::.| ::||::       ..|..|.|....:..|.|:  |..:|..:..::.::.....|...:
 Frog  3148 VYVHPSIQGLQNEYHNGIIQNSVTFSCDAYGIPVPTLR--WLKDGHPIGLTDSLEIQILSGGSKM 3210

  Fly  3191 DISYLQDHDSGEYVCRAWNKYGEDFTRTTLNCGGRGGVFYDSLQPDSLQRIRELECPQGQQADTS 3255
            .|:..|..|.|.|.|.|.|..|                                           
 Frog  3211 KIARAQLTDGGTYTCLASNVEG------------------------------------------- 3232

  Fly  3256 APLVAEPPKFITQIVDVTKLVEGQSAHFEARLTP------ITD----PDLVVEWYFNGKKLPHGH 3310
               .||....:|  :.|...::|.....|..:.|      |.:    |..|:.|..:||.:    
 Frog  3233 ---TAEKTYILT--IQVPPSIDGSGMTNELNVLPGEIIQLICNAKGIPTPVIHWLKDGKHI---- 3288

  Fly  3311 RFRTFHDF-GI------VILDILYCYEENSGVYEARARNKYGEDVTRASLKCASKSSLILDSQLP 3368
               |..|: ||      .||.|......:.|.|...|.|..|||                     
 Frog  3289 ---TSEDYLGINITSDGEILTISKTQTSDMGKYTCVATNPAGED--------------------- 3329

  Fly  3369 RGMEGGLEKIANLEYSMVRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKL 3433
                   ::|.|:...:.    ...::.||...|.|..|:...|:    ..|.....||      
 Frog  3330 -------DRIYNVNVFVA----PKIDDNKGTPVVLTAVLDTSINV----ECHASGFPTP------ 3373

  Fly  3434 KVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYG--------------- 3483
            ::.|..||.||...|:.|  ...|..:|.||.|...|...|:|.|.|..|               
 Frog  3374 QINWLKNGLPLPVSSQVR--LQSGGQVLRISRVQKSDGATYTCIASNRAGVDKKDYNIQVYVSPS 3436

  Fly  3484 --EAVTTATMKIQGKRSIIM----------------------ESQLP----KGM-----EGTIDR 3515
              ||..|..:.:.....::|                      :..||    :||     :..:|.
 Frog  3437 LDEADVTQQITVIRDDPVVMRCIANGVPAPRISWLKDGRQLGDEYLPYIQSQGMVLHIVKAKMDD 3501

  Fly  3516 IAEL-----EGLGSRSTEFVPDDDTGKPPEF----ITSPFDMVIGENALAHFECRLQPINDPSMR 3571
            ||..     ...|..|..|:.  :..:||..    :|....:|:.    .|.:........|...
 Frog  3502 IARYTCVASNAAGRVSKHFIL--NVMEPPHINGSEVTEELSVVVN----THLDLLCYTTGFPPPL 3560

  Fly  3572 VDWFHNGKALWAGSRIKTINDFGFVILEIAGCYQRDSGLYTCKATNKHGEATVSCKLQVKGRQGI 3636
            :.|..:|:.|.....:..:.  ...:|.|....:.:.|.:.|.|:|..|:.          ::..
 Frog  3561 ITWLKDGQPLSQNDNMHLMK--AGQVLRITSAQEENVGRFVCLASNHAGDT----------KKEF 3613

  Fly  3637 VMEPQLPSNFR--TGTES---LQKLEETMHKREELVTEDEQPNPPKFTEEIKDNLDVPEGGPIHF 3696
            :::..:|.|..  :||::   |||.:.||                                    
 Frog  3614 LVKVHIPPNIAGVSGTQNITVLQKKQITM------------------------------------ 3642

  Fly  3697 DCRVEPVGDPTMRIEWFYNGHVMATGSRVHQLNDFGFIALDVDYIYARDSGEYTCRATNKWGTAT 3761
            :|:.:.:  |..||.|..:|..:.....||.|::..|:  .:|.....|:|.|||.|||..|..|
 Frog  3643 ECKSDAL--PPPRITWLKDGQPLQPSPMVHILSNGQFV--QIDNTEVTDTGRYTCIATNIAGKTT 3703

  Fly  3762 TSAKVTCKGKHNIVYESQLPEGMTSEKLKELERGRIPEAPKVVEEVFGPPKFTTQITSVTVDEAE 3826
                      ...:...|:|                   |.:.|   ||       :.||....|
 Frog  3704 ----------KEFILNIQVP-------------------PSIQE---GP-------SLVTAFVNE 3729

  Fly  3827 AVRFECQVE----PKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRA 3887
            .:..||...    |||      .|.::|. |.|.|..|.:.... .||.|..|...|||:|.|.|
 Frog  3730 PITLECISSGVPLPKT------AWRKDGS-LLSQHNARFLVSQN-GSLYISAVEVADSGQYFCLA 3786

  Fly  3888 INNYGEDRTRATVSCKKLPTILLQNQVPRGMKRSDALTQMEATIKKYTSEVHLTEDDL--FDPDR 3950
            .|..|                                          :|:.|:   ||  :||.|
 Frog  3787 TNAAG------------------------------------------SSQRHI---DLLVYDPPR 3806

  Fly  3951 --KQPPRFVTQIKEQLTLTEMAVTKFECQLAPVGDPNMKVEWFFNGKPL---LHKNRFQPIYDFG 4010
              .:|.....:|..|.||        .|::  .|.|..|::|..||.|:   |::|.::.:....
 Frog  3807 IKSEPTNITAKINIQTTL--------PCEV--TGTPKPKIQWKKNGHPINTDLNQNMYRLLSSGS 3861

  Fly  4011 YVAMNFGWVYP--EDSGEYVCRATNLYGKDETRAIIKVSGKPGIVYDSQLPAHMQSIDRIREMEA 4073
            .|.::     |  :|:|.|||.|.:..|.||              .|..|..|            
 Frog  3862 LVIIS-----PSVDDTGIYVCSALSDAGDDE--------------IDMYLSVH------------ 3895

  Fly  4074 SWQVVPDEVDPDAKPRTKPVFVSKLEPQTVEEGDPARFCVRVTGHPRPRVMWLING-HTVVHGSR 4137
                    |.|........:||:||.|..:.       |. |:|.|.|.|.||.:. ........
 Frog  3896 --------VPPTIADEAANIFVTKLSPAVIP-------CT-VSGVPFPSVHWLKDSIQLPAISDS 3944

  Fly  4138 YKLTNDGMFHLDVPKTRQYDTGKVEVIARNSVGE-----SIATTELKVVARSDDYRNVLKNSPRP 4197
            |::...|  .|::|.:|....||....|.|.||.     ::...|:.|:...:||          
 Frog  3945 YRILPSG--SLEIPSSRLSHAGKYTCRAVNQVGSAHIHVNLHVQEVPVIKEQNDY---------- 3997

  Fly  4198 WYDYELAAYQKERQENELEKVFDERKQVLSEQSSHTLKGVEHLKPKQYKPPTPDWQQNVKAKKSE 4262
                             ||.|......:..|.|...:             ||..||:.....||.
 Frog  3998 -----------------LEVVLSNSVTLACEASGTPI-------------PTISWQKEGVGIKSG 4032

  Fly  4263 DYYNKLQTLETEQLLKETNLRRDTHQYAIPGEKVVSSSQAKGMAQSYEENLQEKTSTTEVQAAPP 4327
            ..|.         :|...||            .:.|::             ||...|....|..|
 Frog  4033 SSYT---------ILSNGNL------------NIASAT-------------QEDAGTYTCIAQNP 4063

  Fly  4328 KGIAQPSESSVHGREVHMNKQQQVQKEIQGDLEITRKITATETTEVEHKGTIQERVVQGPVKPAK 4392
            .|.|                    .|:|:..:.:...|       |.|:   :|.|:.       
 Frog  4064 AGTA--------------------LKKIRLKVHVPPVI-------VPHQ---KEYVIS------- 4091

  Fly  4393 APVFTKKIQPCRVFENEQAKFEVEFEGEPNPTVKWYRESFPIQNSPDLQIHTFSGKSILIIRQVF 4457
               ..|.|.           ...|..|.|.|.:.|:::..|:......::....|..|.:::.  
 Frog  4092 ---MDKSIM-----------IVCEAHGSPTPEIIWHKDGVPLAKLAGQRMSATGGLHIAVVQP-- 4140

  Fly  4458 VEDSAVFSCVAENRGGTAKCSANLVVEERRRAGKGGIQPPSFVTTIQSTTVATGQLARFDAKVTG 4522
             :|:..::|.|||..|:...|.||.|          :.||..|..|:..:|.............|
 Frog  4141 -DDAGEYTCTAENIAGSVNSSMNLSV----------LVPPRIVKNIKDVSVVINDQTTLPCAAHG 4194

  Fly  4523 TRPLDVYWLKNGMKIQPSI-KFKMLEEDSVHTLLIIEPFAEDSGRYECVAVNAAGEARCDGDCIV 4586
            .....:.|.||.:.|.... |:.:|....   |::.....:|.|.|.|.|.||.||........|
 Frog  4195 IPTPTITWAKNNLPITVKAGKYSVLASGE---LILYNAQHKDVGTYTCTASNAIGEDTHTVRLTV 4256

  Fly  4587 QSPSKPEKPTTPGSEKAPHIVEQLKSQTVEEGSKVIFRCRVDGKPTPTARWMRGENFVKPSRYFQ 4651
            ..|        |...:.|.||      ::.||.::...|:..|.|.|...|:..:..:.   ..|
 Frog  4257 HFP--------PSFTEMPTIV------SLNEGERLSLLCKATGNPLPHTTWIFKDKILP---VLQ 4304

  Fly  4652 MSRQGEYYQLVISEAFPEDEGTYKCVAENKLGSIQTSAQLKVRPIENLDAPPTITAL--KDVSVT 4714
            ..|..:..:|||.:...|:.|.|.|||||.:.||.|:..:.|:      .||.:..:  |..:|.
 Frog  4305 DRRSKQQNELVIDKVSRENSGAYMCVAENIVASINTTIHVFVK------EPPVLNGVHNKHRTVP 4363

  Fly  4715 EGMPAQFKTTVTGKVKATSVQWFREGQLIPETPDFQMIFDGNSAVLLIGTTYEEDSGIFTVRVTS 4779
            .|........|.|. ....:||.::.::|......:...:|:.|:...|.   ||.|.:|....:
 Frog  4364 LGGNIILNCVVKGN-PFPKIQWHKKAKVISYNKHIKEFSNGSLAIYDAGL---EDVGDYTCIAAN 4424

  Fly  4780 STGQVESSAKLTVKKRRISAFQLRTIDSAEDESSSSGREDSAPESPHAFQPGQQPGQQFGQFLGV 4844
            ..|.:|.:..||:  :|....::..:|:..|.                           |..:.:
 Frog  4425 DAGVLEHTVTLTL--QRPPTIKVPPLDTTVDA---------------------------GATVAL 4460

  Fly  4845 NGQGQHQGRSRQKKPKVRSKSLQPATKVIPWRKSSRPTRGRSLDKGVFLPGFKPEPVKSWTEET- 4908
            |.|.:.:                 ....|.|.:.:.|.  .|.|:...||....:.|.:..|:| 
 Frog  4461 NCQSEGE-----------------PVPTITWYRRNNPI--SSEDRITILPNNSLQIVSAQKEDTS 4506

  Fly  4909 -INLKATPIEKKKPAPKLEAAKVVLKSIKTERDQGIMSLGATLEQIIAGKTEKEAIPWITMREKL 4972
             ...|||.|          ....|:|...|.:..|..|               |.:||.:.  .:
 Frog  4507 VYECKATNI----------MGTDVVKVTFTVQVHGGFS---------------EWLPWQSC--SV 4544

  Fly  4973 KAVESVQQQLNKFDLDEVYLQPLEGQIETEGQLPQQAQVEQVQRTKEIQRLKSMESVEIMEMTDQ 5037
            ...:.:||::...|      .||..   ..|...|.|:.|    |:..|                
 Frog  4545 TCGQGIQQRIRLCD------NPLPA---NGGNYCQGAETE----TRSCQ---------------- 4580

  Fly  5038 IDKLITQQQNAKDLIPWKEMRQQLKSVQR 5066
             :||.....|..:...|:|..:...|.:|
 Frog  4581 -NKLCPVDGNWSEWSTWEECSRSCGSGKR 4608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slsNP_001261304.1 I-set 87..174 CDD:254352 19/55 (35%)
Ig 109..175 CDD:143165 19/56 (34%)
Ig 254..334 CDD:299845 22/79 (28%)
I-set 255..344 CDD:254352 25/88 (28%)
I-set 372..462 CDD:254352 25/89 (28%)
Ig 390..463 CDD:299845 23/72 (32%)
Ig 471..561 CDD:299845 29/96 (30%)
I-set 471..560 CDD:254352 29/95 (31%)
I-set 618..709 CDD:254352 25/95 (26%)
Ig 645..705 CDD:143165 18/59 (31%)
DUF1136 715..741 CDD:284093 7/25 (28%)
IG_like 762..843 CDD:214653 23/80 (29%)
Ig 779..835 CDD:143165 19/55 (35%)
I-set 890..982 CDD:254352 21/91 (23%)
Ig 918..979 CDD:143165 19/60 (32%)
DUF1136 988..1014 CDD:284093 3/25 (12%)
I-set 1024..1116 CDD:254352 21/92 (23%)
Ig 1058..1113 CDD:143165 14/55 (25%)
I-set 1158..1250 CDD:254352 25/91 (27%)
Ig 1178..1246 CDD:143165 21/67 (31%)
DUF1136 1256..1282 CDD:284093 8/82 (10%)
I-set 1291..1380 CDD:254352 23/95 (24%)
IGc2 1304..1372 CDD:197706 19/71 (27%)
DUF1136 1388..1414 CDD:284093 2/25 (8%)
I-set 1424..1515 CDD:254352 28/117 (24%)
Ig 1442..1513 CDD:143165 22/97 (23%)
DUF1136 1522..1548 CDD:284093 6/45 (13%)
I-set 1558..1645 CDD:254352 27/86 (31%)
IGc2 1571..1639 CDD:197706 21/67 (31%)
DUF1136 1655..1679 CDD:284093 8/51 (16%)
I-set 1691..1782 CDD:254352 29/121 (24%)
IGc2 1718..1772 CDD:197706 19/54 (35%)
DUF1136 1788..1814 CDD:284093 3/25 (12%)
I-set 1824..1916 CDD:254352 20/91 (22%)
IGc2 1838..1906 CDD:197706 17/67 (25%)
DUF1136 1922..1948 CDD:284093 2/25 (8%)
I-set 1958..2049 CDD:254352 26/94 (28%)
Ig 1985..2044 CDD:143165 17/58 (29%)
I-set 2089..2181 CDD:254352 18/91 (20%)
IGc2 2103..2171 CDD:197706 16/67 (24%)
DUF1136 2187..2213 CDD:284093 4/25 (16%)
I-set 2222..2314 CDD:254352 18/91 (20%)
IGc2 2236..2304 CDD:197706 14/67 (21%)
DUF1136 2320..2346 CDD:284093 1/25 (4%)
I-set 2356..2448 CDD:254352 25/112 (22%)
Ig 2384..2445 CDD:143165 19/62 (31%)
DUF1136 2454..2480 CDD:284093 4/28 (14%)
I-set 2488..2580 CDD:254352 28/145 (19%)
Ig 2516..2576 CDD:143165 18/59 (31%)
I-set 2622..2714 CDD:254352 27/98 (28%)
IGc2 2636..2704 CDD:197706 23/74 (31%)
I-set 2754..2844 CDD:254352 25/97 (26%)
Ig 2771..2840 CDD:143165 21/76 (28%)
IGc2 2908..2974 CDD:197706 12/65 (18%)
I-set 3029..3120 CDD:254352 26/98 (27%)
Ig 3057..3116 CDD:143165 18/60 (30%)
I-set 3130..3220 CDD:254352 21/98 (21%)
Ig 3148..3219 CDD:143165 16/70 (23%)
I-set 3263..3354 CDD:254352 25/107 (23%)
I-set 3401..3493 CDD:254352 28/108 (26%)
Ig 3429..3490 CDD:143165 21/77 (27%)
I-set 3539..3630 CDD:254352 15/94 (16%)
Ig 3556..3625 CDD:143165 12/68 (18%)
I-set 3676..3767 CDD:254352 21/90 (23%)
IGc2 3690..3758 CDD:197706 19/67 (28%)
I-set 3811..3900 CDD:254352 26/92 (28%)
Ig 3828..3899 CDD:143165 23/74 (31%)
I-set 3954..4046 CDD:254352 25/96 (26%)
Ig 3963..4042 CDD:299845 24/83 (29%)
I-set 4092..4180 CDD:254352 25/93 (27%)
Ig 4102..4172 CDD:299845 19/75 (25%)
I-set 4394..4483 CDD:254352 19/88 (22%)
Ig 4411..4480 CDD:143165 15/68 (22%)
I-set 4497..4581 CDD:254352 21/84 (25%)
Ig 4519..4580 CDD:143165 17/61 (28%)
I-set 4604..4693 CDD:254352 26/88 (30%)
Ig 4621..4691 CDD:299845 21/69 (30%)
I-set 4702..4792 CDD:254352 20/91 (22%)
Ig 4702..4791 CDD:299845 19/90 (21%)
COG4372 4996..>5260 CDD:226809 13/71 (18%)
I-set 6536..6622 CDD:254352
Ig 6554..6622 CDD:143165
Ig 6654..6725 CDD:143165
I-set 6743..6829 CDD:254352
Ig 6760..6829 CDD:299845
I-set 6841..6928 CDD:254352
Ig 6858..6927 CDD:143165
I-set 6942..7033 CDD:254352
IGc2 6957..7023 CDD:197706
I-set 7066..7157 CDD:254352
Ig 7084..7153 CDD:143165
IGc2 7224..7289 CDD:197706
Ehrlichia_rpt 14571..15030 CDD:118064
SH3_p47phox_like 16753..16807 CDD:212790
I-set 16841..16931 CDD:254352
Ig 16858..16931 CDD:299845
I-set 16965..17060 CDD:254352
IGc2 16978..17050 CDD:197706
I-set 17068..17152 CDD:254352
Ig_2 17078..17152 CDD:290606
IG_like 17170..17253 CDD:214653
Ig 17180..17250 CDD:143165
I-set 17260..17342 CDD:254352
IGc2 17274..17331 CDD:197706
I-set 17347..17432 CDD:254352
IGc2 17367..17423 CDD:197706
I-set 17437..17521 CDD:254352
Ig <17468..17521 CDD:299845
I-set 17528..17611 CDD:254352
Ig 17553..17602 CDD:143165
I-set 17618..17708 CDD:254352
Ig 17635..17708 CDD:299845
FN3 17712..17791 CDD:238020
I-set 17813..17898 CDD:254352
Ig 17830..17894 CDD:143165
Ig 17922..17994 CDD:299845
FN3 17998..18090 CDD:238020
FN3 18098..18189 CDD:238020
FN3 18207..18298 CDD:238020
FN3 18307..18398 CDD:238020
hmcn1XP_012816895.2 Ig strand A 2010..2015 CDD:409353 0/4 (0%)
I-set 2011..2099 CDD:400151 26/91 (29%)
Ig strand A' 2019..2025 CDD:409353 1/5 (20%)
Ig strand B 2026..2036 CDD:409353 2/9 (22%)
Ig strand C 2040..2046 CDD:409353 4/7 (57%)
Ig strand C' 2048..2050 CDD:409353 1/1 (100%)
Ig strand D 2057..2060 CDD:409353 0/2 (0%)
Ig strand E 2065..2071 CDD:409353 2/5 (40%)
Ig strand F 2077..2086 CDD:409353 5/8 (63%)
Ig strand G 2089..2101 CDD:409353 4/11 (36%)
Ig_3 2102..2177 CDD:404760 21/117 (18%)
Ig strand A 2102..2105 CDD:409353 0/2 (0%)
Ig strand A' 2111..2114 CDD:409353 0/34 (0%)
Ig strand B 2120..2127 CDD:409353 1/13 (8%)
Ig strand C 2133..2138 CDD:409353 2/6 (33%)
Ig strand C' 2141..2143 CDD:409353 1/1 (100%)
Ig strand D 2149..2153 CDD:409353 1/3 (33%)
Ig strand E 2155..2160 CDD:409353 1/4 (25%)
Ig strand F 2169..2177 CDD:409353 3/7 (43%)
Ig strand G 2180..2190 CDD:409353 1/9 (11%)
Ig 2194..2285 CDD:416386 30/132 (23%)
Ig strand A 2194..2197 CDD:409353 1/25 (4%)
Ig strand A' 2202..2207 CDD:409353 2/19 (11%)
Ig strand B 2213..2220 CDD:409353 1/6 (17%)
Ig strand C 2226..2231 CDD:409353 1/6 (17%)
Ig strand C' 2233..2235 CDD:409353 0/1 (0%)
Ig strand D 2243..2247 CDD:409353 0/3 (0%)
Ig strand E 2251..2257 CDD:409353 2/5 (40%)
Ig strand F 2264..2271 CDD:409353 2/6 (33%)
Ig strand G 2277..2285 CDD:409353 2/7 (29%)
Ig_3 2288..2366 CDD:404760 19/88 (22%)
Ig strand A' 2300..2304 CDD:409353 0/3 (0%)
Ig strand B 2308..2315 CDD:409353 3/8 (38%)
Ig strand C 2322..2327 CDD:409353 1/4 (25%)
Ig strand C' 2329..2332 CDD:409353 1/2 (50%)
Ig strand D 2337..2341 CDD:409353 0/3 (0%)
Ig strand E 2344..2351 CDD:409353 1/6 (17%)
Ig strand F 2358..2366 CDD:409353 4/7 (57%)
Ig strand B 2403..2407 CDD:409353 0/3 (0%)
Ig 2404..2473 CDD:416386 18/90 (20%)
Ig strand C 2416..2420 CDD:409353 0/3 (0%)
Ig strand E 2439..2443 CDD:409353 1/4 (25%)
Ig strand F 2453..2458 CDD:409353 1/4 (25%)
I-set 2477..2565 CDD:400151 28/102 (27%)
Ig strand B 2495..2499 CDD:409353 2/10 (20%)
Ig strand C 2508..2512 CDD:409353 0/3 (0%)
Ig strand E 2531..2535 CDD:409353 1/7 (14%)
Ig strand F 2545..2550 CDD:409353 2/4 (50%)
Ig 2579..2660 CDD:416386 18/92 (20%)
Ig strand A' 2579..2584 CDD:409353 0/4 (0%)
Ig strand B 2590..2597 CDD:409353 1/6 (17%)
Ig strand C 2603..2608 CDD:409353 1/15 (7%)
Ig strand C' 2610..2612 CDD:409353 0/1 (0%)
Ig strand D 2619..2622 CDD:409353 0/2 (0%)
Ig strand E 2626..2632 CDD:409353 0/5 (0%)
Ig strand F 2639..2646 CDD:409353 0/6 (0%)
Ig strand G 2652..2660 CDD:409353 4/8 (50%)
I-set 2673..2758 CDD:400151 19/99 (19%)
Ig strand B 2689..2693 CDD:409353 0/3 (0%)
Ig strand C 2702..2706 CDD:409353 1/3 (33%)
Ig strand E 2725..2728 CDD:409353 2/2 (100%)
Ig strand F 2738..2743 CDD:409353 2/4 (50%)
Ig strand B 2794..2798 CDD:409353 0/3 (0%)
Ig 2795..2857 CDD:416386 21/81 (26%)
Ig strand C 2807..2811 CDD:409353 1/3 (33%)
Ig strand E 2830..2834 CDD:409353 1/3 (33%)
Ig strand F 2844..2849 CDD:409353 3/4 (75%)
I-set 2878..2961 CDD:400151 27/108 (25%)
Ig strand A' 2886..2889 CDD:409353 1/8 (13%)
Ig strand C 2904..2909 CDD:409353 2/4 (50%)
Ig strand C' 2911..2913 CDD:409353 1/1 (100%)
Ig strand D 2919..2923 CDD:409353 2/13 (15%)
Ig strand E 2926..2932 CDD:409353 0/5 (0%)
Ig strand F 2940..2948 CDD:409353 3/7 (43%)
Ig_3 2964..3040 CDD:404760 21/112 (19%)
Ig strand A 2967..2970 CDD:409353 0/2 (0%)
Ig strand A' 2974..2977 CDD:409353 0/2 (0%)
Ig strand B 2983..2990 CDD:409353 2/7 (29%)
Ig strand C 2996..3001 CDD:409353 1/36 (3%)
Ig strand D 3011..3015 CDD:409353 0/3 (0%)
Ig strand E 3018..3024 CDD:409353 1/5 (20%)
Ig strand F 3032..3040 CDD:409353 4/7 (57%)
Ig strand G 3043..3053 CDD:409353 5/50 (10%)
Ig strand A 3056..3061 CDD:409353 2/4 (50%)
Ig strand A' 3067..3073 CDD:409353 2/6 (33%)
I-set 3070..3148 CDD:400151 26/100 (26%)
Ig strand B 3076..3086 CDD:409353 1/9 (11%)
Ig strand C 3090..3096 CDD:409353 3/5 (60%)
Ig strand C' 3098..3100 CDD:409353 1/1 (100%)
Ig strand D 3106..3109 CDD:409353 1/2 (50%)
Ig strand E 3114..3120 CDD:409353 1/5 (20%)
Ig strand F 3126..3135 CDD:409353 4/8 (50%)
Ig strand G 3138..3150 CDD:409353 3/25 (12%)
Ig 3169..3242 CDD:416386 20/122 (16%)
Ig strand B 3170..3174 CDD:409353 1/3 (33%)
Ig strand C 3183..3187 CDD:409353 1/5 (20%)
Ig strand E 3208..3212 CDD:409353 0/3 (0%)
Ig strand F 3222..3227 CDD:409353 2/4 (50%)
Ig strand A 3245..3250 CDD:409353 0/4 (0%)
Ig strand A' 3254..3260 CDD:409353 1/5 (20%)
I-set 3259..3329 CDD:400151 19/76 (25%)
Ig strand B 3263..3273 CDD:409353 1/9 (11%)
Ig strand C 3277..3283 CDD:409353 2/5 (40%)
Ig strand C' 3285..3287 CDD:409353 1/1 (100%)
Ig strand D 3295..3298 CDD:409353 2/2 (100%)
Ig strand E 3303..3309 CDD:409353 3/5 (60%)
Ig strand F 3315..3324 CDD:409353 3/8 (38%)
Ig strand G 3327..3339 CDD:409353 5/39 (13%)
I-set 3341..3431 CDD:400151 27/101 (27%)
Ig strand B 3361..3368 CDD:409353 2/10 (20%)
Ig strand C 3374..3379 CDD:409353 1/4 (25%)
Ig strand C' 3381..3383 CDD:409353 1/1 (100%)
Ig strand D 3389..3393 CDD:409353 1/5 (20%)
Ig strand E 3397..3402 CDD:409353 1/4 (25%)
Ig strand F 3411..3417 CDD:409353 2/5 (40%)
Ig 3444..3524 CDD:416386 11/81 (14%)
Ig strand A' 3445..3448 CDD:409353 0/2 (0%)
Ig strand B 3454..3461 CDD:409353 1/6 (17%)
Ig strand C 3467..3472 CDD:409353 0/4 (0%)
Ig strand C' 3474..3476 CDD:409353 0/1 (0%)
Ig strand D 3481..3486 CDD:409353 2/4 (50%)
Ig strand E 3489..3495 CDD:409353 2/5 (40%)
Ig strand F 3503..3511 CDD:409353 1/7 (14%)
Ig strand G 3514..3524 CDD:409353 3/11 (27%)
Ig strand A 3527..3532 CDD:409353 2/4 (50%)
Ig strand A' 3536..3542 CDD:409353 1/5 (20%)
Ig 3539..3617 CDD:416386 13/93 (14%)
Ig strand B 3545..3555 CDD:409353 1/9 (11%)
Ig strand C 3559..3565 CDD:409353 1/5 (20%)
Ig strand C' 3567..3569 CDD:409353 1/1 (100%)
vWFA 43..199 CDD:238119
MD 295..418 CDD:214741
IGc2 446..507 CDD:197706 17/49 (35%)
Ig strand B 449..452 CDD:409353
Ig strand C 461..465 CDD:409353 1/2 (50%)
Ig strand E 483..487 CDD:409353 1/3 (33%)
Ig strand F 497..502 CDD:409353 2/4 (50%)
Ig strand G 511..514 CDD:409353 0/2 (0%)
Ig 521..608 CDD:416386 24/87 (28%)
Ig strand A' 529..532 CDD:409353 0/2 (0%)
Ig strand B 538..545 CDD:409353 2/6 (33%)
Ig strand C 551..556 CDD:409353 3/4 (75%)
Ig strand C' 558..560 CDD:409353 0/1 (0%)
Ig strand D 568..572 CDD:409353 1/3 (33%)
Ig strand E 575..580 CDD:409353 1/4 (25%)
Ig strand F 588..596 CDD:409353 3/7 (43%)
Ig strand G 599..607 CDD:409353 2/7 (29%)
I-set 613..691 CDD:400151 27/108 (25%)
Ig strand A' 621..624 CDD:409353 1/26 (4%)
Ig strand B 630..637 CDD:409353 1/6 (17%)
Ig strand C 643..648 CDD:409353 1/4 (25%)
Ig strand C' 650..652 CDD:409353 0/1 (0%)
Ig strand D 658..663 CDD:409353 0/4 (0%)
Ig strand E 665..669 CDD:409353 1/5 (20%)
Ig strand F 678..686 CDD:409353 4/7 (57%)
Ig strand G 689..700 CDD:409353 3/13 (23%)
Ig_3 703..777 CDD:404760 25/75 (33%)
Ig strand A' 709..714 CDD:409353 1/4 (25%)
Ig strand B 718..725 CDD:409353 1/6 (17%)
Ig strand C 733..737 CDD:409353 1/3 (33%)
Ig strand D 749..752 CDD:409353 0/2 (0%)
Ig strand E 756..761 CDD:409353 1/4 (25%)
Ig strand F 769..777 CDD:409353 4/7 (57%)
Ig strand G 783..790 CDD:409353 1/6 (17%)
I-set 794..885 CDD:400151 6/90 (7%)
Ig strand A 794..797 CDD:409353 0/2 (0%)
Ig strand A' 802..805 CDD:409353 0/2 (0%)
Ig strand B 811..818 CDD:409353 0/6 (0%)
Ig strand C 824..835 CDD:409353 4/10 (40%)
Ig strand C' 838..840 CDD:409353 0/1 (0%)
Ig strand D 845..849 CDD:409353 0/3 (0%)
Ig strand E 851..855 CDD:409353 0/3 (0%)
Ig strand F 864..872 CDD:409353 0/7 (0%)
Ig strand G 875..885 CDD:409353 0/9 (0%)
Ig_3 891..965 CDD:404760 12/75 (16%)
Ig strand A' 899..901 CDD:409353 0/1 (0%)
Ig strand B 907..915 CDD:409353 0/7 (0%)
Ig strand C 922..927 CDD:409353 1/4 (25%)
Ig strand C' 929..932 CDD:409353 0/2 (0%)
Ig strand D 937..941 CDD:409353 0/3 (0%)
Ig strand E 944..950 CDD:409353 1/5 (20%)
Ig strand F 957..965 CDD:409353 0/7 (0%)
Ig strand G 968..972 CDD:409353 0/3 (0%)
Ig strand G' 974..978 CDD:409353 0/3 (0%)
PHA02785 991..1258 CDD:165149 81/354 (23%)
Ig 1268..1355 CDD:416386 25/145 (17%)
Ig strand A' 1272..1275 CDD:409353 0/2 (0%)
Ig strand B 1284..1291 CDD:409353 2/6 (33%)
Ig strand C 1297..1302 CDD:409353 3/4 (75%)
Ig strand C' 1305..1307 CDD:409353 0/1 (0%)
Ig strand D 1313..1319 CDD:409353 0/5 (0%)
Ig strand E 1321..1325 CDD:409353 0/3 (0%)
Ig strand F 1334..1342 CDD:409353 4/7 (57%)
Ig strand G 1345..1355 CDD:409353 1/31 (3%)
Ig 1366..1448 CDD:416386 27/97 (28%)
Ig strand B 1378..1382 CDD:409353 1/3 (33%)
Ig strand C 1391..1395 CDD:409353 0/3 (0%)
Ig strand E 1413..1418 CDD:409353 2/5 (40%)
Ig strand F 1428..1433 CDD:409353 2/4 (50%)
Ig strand G 1442..1445 CDD:409353 0/2 (0%)
I-set 1457..1542 CDD:400151 9/84 (11%)
Ig strand A' 1462..1465 CDD:409353 0/2 (0%)
Ig strand B 1471..1478 CDD:409353 0/6 (0%)
Ig strand C 1484..1489 CDD:409353 0/4 (0%)
Ig strand C' 1491..1493 CDD:409353 0/1 (0%)
Ig strand D 1500..1504 CDD:409353 1/3 (33%)
Ig strand E 1507..1513 CDD:409353 2/5 (40%)
Ig strand F 1521..1529 CDD:409353 0/7 (0%)
Ig strand G 1532..1542 CDD:409353 1/9 (11%)
Ig 1565..1629 CDD:416386 19/71 (27%)
Ig strand B 1565..1569 CDD:409353 1/3 (33%)
Ig strand C 1578..1582 CDD:409353 1/3 (33%)
Ig strand E 1601..1605 CDD:409353 1/3 (33%)
Ig strand F 1615..1620 CDD:409353 3/4 (75%)
I-set 1649..1729 CDD:400151 26/104 (25%)
Ig strand B 1659..1666 CDD:409353 5/17 (29%)
Ig strand C 1672..1677 CDD:409353 1/4 (25%)
Ig strand D 1688..1691 CDD:409353 1/3 (33%)
Ig strand E 1695..1701 CDD:409353 2/5 (40%)
Ig strand F 1708..1715 CDD:409353 4/6 (67%)
Ig strand G 1721..1729 CDD:409353 1/7 (14%)
I-set 1741..1822 CDD:400151 17/80 (21%)
Ig strand A' 1743..1746 CDD:409353 0/2 (0%)
Ig strand B 1752..1759 CDD:409353 4/6 (67%)
Ig strand C 1765..1770 CDD:409353 1/4 (25%)
Ig strand C' 1772..1774 CDD:409353 1/1 (100%)
Ig strand D 1780..1784 CDD:409353 0/3 (0%)
Ig strand E 1787..1793 CDD:409353 2/5 (40%)
Ig strand F 1801..1809 CDD:409353 1/7 (14%)
Ig <1844..1914 CDD:416386 26/82 (32%)
Ig strand C 1856..1860 CDD:409353 0/3 (0%)
Ig strand C' 1863..1866 CDD:409353 1/2 (50%)
Ig strand D 1872..1876 CDD:409353 0/3 (0%)
Ig strand E 1880..1885 CDD:409353 1/4 (25%)
Ig strand F 1893..1901 CDD:409353 5/7 (71%)
Ig strand G 1904..1914 CDD:409353 5/19 (26%)
Ig 1937..2007 CDD:416386 10/69 (14%)
Ig strand B 1937..1941 CDD:409353 0/3 (0%)
Ig strand C 1950..1954 CDD:409353 0/3 (0%)
Ig strand E 1973..1977 CDD:409353 0/3 (0%)
Ig strand F 1987..1992 CDD:409353 0/4 (0%)
Ig strand D 3576..3579 CDD:409353 0/2 (0%)
Ig strand E 3583..3589 CDD:409353 2/5 (40%)
Ig strand F 3595..3604 CDD:409353 3/8 (38%)
Ig strand G 3607..3617 CDD:409353 1/19 (5%)
I-set 3630..3710 CDD:400151 26/129 (20%)
Ig strand A' 3631..3634 CDD:409353 0/2 (0%)
Ig strand B 3640..3647 CDD:409353 3/42 (7%)
Ig strand C 3653..3658 CDD:409353 3/4 (75%)
Ig strand C' 3660..3662 CDD:409353 1/1 (100%)
Ig strand D 3668..3672 CDD:409353 2/3 (67%)
Ig strand E 3675..3681 CDD:409353 1/7 (14%)
Ig strand F 3689..3697 CDD:409353 5/7 (71%)
Ig_3 3713..3788 CDD:404760 29/111 (26%)
Ig strand A' 3722..3725 CDD:409353 1/2 (50%)
Ig strand B 3731..3738 CDD:409353 2/6 (33%)
Ig strand C 3744..3749 CDD:409353 3/10 (30%)
Ig strand C' 3751..3753 CDD:409353 1/2 (50%)
Ig strand D 3760..3764 CDD:409353 1/3 (33%)
Ig strand E 3767..3772 CDD:409353 2/4 (50%)
Ig strand F 3780..3788 CDD:409353 4/7 (57%)
Ig strand G 3791..3801 CDD:409353 5/54 (9%)
Ig_3 3804..3879 CDD:404760 24/89 (27%)
Ig strand B 3823..3826 CDD:409353 2/10 (20%)
Ig strand C 3835..3839 CDD:409353 1/3 (33%)
Ig strand E 3860..3864 CDD:409353 0/3 (0%)
Ig strand F 3874..3879 CDD:409353 3/4 (75%)
Ig strand A' 3906..3909 CDD:409353 0/2 (0%)
Ig 3908..3985 CDD:416386 24/86 (28%)
Ig strand B 3915..3922 CDD:409353 1/14 (7%)
Ig strand C 3928..3933 CDD:409353 2/4 (50%)
Ig strand C' 3935..3937 CDD:409353 0/1 (0%)
Ig strand D 3944..3948 CDD:409353 1/3 (33%)
Ig strand E 3951..3956 CDD:409353 2/6 (33%)
Ig strand F 3964..3972 CDD:409353 3/7 (43%)
Ig strand G 3975..3985 CDD:409353 1/9 (11%)
I-set 3989..4075 CDD:400151 28/179 (16%)
Ig strand B 4006..4013 CDD:409353 1/6 (17%)
Ig strand C 4019..4024 CDD:409353 2/4 (50%)
Ig strand C' 4026..4028 CDD:409353 0/1 (0%)
Ig strand D 4034..4038 CDD:409353 1/12 (8%)
Ig strand E 4041..4046 CDD:409353 2/16 (13%)
Ig strand F 4054..4062 CDD:409353 2/7 (29%)
Ig strand G 4065..4075 CDD:409353 4/29 (14%)
Ig_3 4078..4152 CDD:404760 18/107 (17%)
Ig strand C 4109..4113 CDD:409353 0/3 (0%)
Ig strand C' 4116..4119 CDD:409353 0/2 (0%)
Ig strand D 4126..4129 CDD:409353 0/2 (0%)
Ig strand E 4131..4136 CDD:409353 1/4 (25%)
Ig strand F 4144..4152 CDD:409353 2/7 (29%)
Ig strand G 4155..4165 CDD:409353 4/9 (44%)
Ig strand A 4168..4171 CDD:409353 2/2 (100%)
I-set 4169..4256 CDD:400151 21/89 (24%)
Ig strand A' 4177..4180 CDD:409353 0/2 (0%)
Ig strand B 4185..4193 CDD:409353 0/7 (0%)
Ig strand C 4199..4203 CDD:409353 0/3 (0%)
Ig strand C' 4206..4209 CDD:409353 0/2 (0%)
Ig strand D 4215..4219 CDD:409353 1/3 (33%)
Ig strand E 4222..4227 CDD:409353 1/7 (14%)
Ig strand F 4235..4243 CDD:409353 4/7 (57%)
Ig strand G 4246..4256 CDD:409353 2/9 (22%)
Ig_3 4259..4333 CDD:404760 23/90 (26%)
putative Ig strand A 4260..4266 CDD:409353 1/5 (20%)
Ig strand B 4277..4281 CDD:409353 0/3 (0%)
Ig strand C 4290..4295 CDD:409353 1/4 (25%)
Ig strand E 4312..4316 CDD:409353 1/3 (33%)
Ig strand F 4326..4331 CDD:409353 2/4 (50%)
Ig strand G 4339..4342 CDD:409353 1/2 (50%)
Ig 4358..4436 CDD:416386 17/81 (21%)
Ig strand B 4368..4375 CDD:409353 0/6 (0%)
Ig strand C 4381..4386 CDD:409353 2/4 (50%)
Ig strand C' 4388..4390 CDD:409353 0/1 (0%)
Ig strand D 4396..4400 CDD:409353 0/3 (0%)
Ig strand E 4403..4408 CDD:409353 2/4 (50%)
Ig strand F 4416..4424 CDD:409353 2/7 (29%)
Ig strand G 4427..4436 CDD:409353 2/8 (25%)
Ig 4443..4527 CDD:416386 21/139 (15%)
Ig strand A' 4449..4452 CDD:409353 1/2 (50%)
Ig strand B 4458..4465 CDD:409353 2/6 (33%)
Ig strand C 4471..4476 CDD:409353 2/4 (50%)
Ig strand C' 4478..4480 CDD:409353 0/1 (0%)
Ig strand D 4486..4490 CDD:409353 0/3 (0%)
Ig strand E 4493..4498 CDD:409353 0/4 (0%)
Ig strand F 4506..4514 CDD:409353 2/7 (29%)
Ig strand G 4517..4527 CDD:409353 2/9 (22%)
TSP1 4534..4585 CDD:214559 17/97 (18%)
TSP1 4590..4642 CDD:214559 4/19 (21%)
TSP1 4647..4699 CDD:214559
TSP1 4704..4756 CDD:214559
TSP1 4761..4813 CDD:214559
TSP1 4818..4870 CDD:214559
nidG2 4869..5093 CDD:412205
cEGF 5128..5151 CDD:403760
EGF_CA 5148..5183 CDD:214542
EGF_CA 5193..5230 CDD:214542
EGF_CA 5231..5272 CDD:214542
EGF_CA 5273..5314 CDD:311536
EGF_CA 5316..5355 CDD:214542
EGF_CA 5356..>5391 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.