DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgm1 and PRTFDC1

DIOPT Version :9

Sequence 1:NP_524675.1 Gene:Pgm1 / 44010 FlyBaseID:FBgn0003076 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_064585.1 Gene:PRTFDC1 / 56952 HGNCID:23333 Length:225 Species:Homo sapiens


Alignment Length:148 Identity:28/148 - (18%)
Similarity:58/148 - (39%) Gaps:34/148 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 KLVRNLQIDI--SKVGVTSFDIAGKPFTVEVIDSVANYVRHMEEI----FDFAKLKDFVSGKATG 215
            :|.:::..||  |.:.|......|..|..::::.:.|..|:.:..    .||.:||.:.:.::.|
Human    55 RLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMG 119

  Fly   216 KPLKMRIDAMNGVTGSYV------------REIFLNRLGATESSVVHTTPL------------PD 256
            :...:..|.::.:.|..|            .:..|:.:...:.:::....|            ||
Human   120 EMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPD 184

  Fly   257 FGGLHPDPNL---TYAKD 271
            :.|.. .|||   .||.|
Human   185 YAGFE-IPNLFVVGYALD 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgm1NP_524675.1 PLN02307 1..560 CDD:177942 28/148 (19%)
PGM1 6..560 CDD:100087 28/148 (19%)
PRTFDC1NP_064585.1 PRTases_typeI 7..224 CDD:320892 28/148 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141581
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.