DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgm1 and hprt1l

DIOPT Version :9

Sequence 1:NP_524675.1 Gene:Pgm1 / 44010 FlyBaseID:FBgn0003076 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001002056.1 Gene:hprt1l / 415146 ZFINID:ZDB-GENE-040625-17 Length:215 Species:Danio rerio


Alignment Length:160 Identity:33/160 - (20%)
Similarity:59/160 - (36%) Gaps:36/160 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 NHIYKITTEIKEYKLVRNLQIDISKVGVTSFDI--AGKPFTVEVIDSVANYVRHMEE----IFDF 202
            |.:.|..||    :|.|::..|:....:.:..:  .|..|..:::|.:....:|.::    ..||
Zfish    36 NGLIKDRTE----RLARDIVRDMGGHHIVALCVLKGGYKFFADLMDFIKTLNQHSDKSVPLTVDF 96

  Fly   203 AKLKDFVSGKATGKPLKMRIDAMNGVTGSYV------------REIFLNRLGATESSVVHTTPL- 254
            .:||.:.:.::|.....:..|.::.:.|..|            .|..|..|......:|....| 
Zfish    97 IRLKSYCNDQSTNCVKVIGGDELSALAGKNVLIVEDIVETGKTMETLLKLLHECHPKMVKVVSLL 161

  Fly   255 -----------PDFGGLH-PDPNLT-YAKD 271
                       ||:.|.. ||..|. ||.|
Zfish   162 VKRTPRSSGYRPDYTGFEVPDKFLVGYALD 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgm1NP_524675.1 PLN02307 1..560 CDD:177942 33/160 (21%)
PGM1 6..560 CDD:100087 33/160 (21%)
hprt1lNP_001002056.1 PRTases_typeI 10..214 CDD:294217 33/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.