DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgm1 and hprt1

DIOPT Version :10

Sequence 1:NP_524675.1 Gene:Pgm1 / 44010 FlyBaseID:FBgn0003076 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_998151.1 Gene:hprt1 / 406259 ZFINID:ZDB-GENE-040426-1918 Length:218 Species:Danio rerio


Alignment Length:147 Identity:31/147 - (21%)
Similarity:58/147 - (39%) Gaps:32/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 KLVRNLQIDISKVGVTSFDI--AGKPFTVEVIDSV----ANYVRHMEEIFDFAKLKDFVSGKATG 215
            :|.|::..|:....:.:..:  .|..|..:::|.:    .|..|.:....||.:||.:.:.::||
Zfish    48 RLARDIMKDMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYQNDQSTG 112

  Fly   216 KPLKMRIDAMNGVTGSYVREI-------------------FLNRLGATESSVVHTTP-----LPD 256
            ....:..|.::.:||..|..:                   :..::....|.:|..||     .||
Zfish   113 DIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMKTLLELLKQYNPKMVKVASLLVKRTPRSVGYRPD 177

  Fly   257 FGGLH-PDPNLT-YAKD 271
            |.|.. ||..:. ||.|
Zfish   178 FVGFEVPDKFVVGYALD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgm1NP_524675.1 PGM1 6..560 CDD:100087 31/147 (21%)
hprt1NP_998151.1 PRTases_typeI 6..218 CDD:444823 31/147 (21%)

Return to query results.
Submit another query.