DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgm1 and Prtfdc1

DIOPT Version :9

Sequence 1:NP_524675.1 Gene:Pgm1 / 44010 FlyBaseID:FBgn0003076 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_038951494.1 Gene:Prtfdc1 / 291355 RGDID:1310177 Length:343 Species:Rattus norvegicus


Alignment Length:209 Identity:39/209 - (18%)
Similarity:68/209 - (32%) Gaps:85/209 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 TGKGIEDILKQHWSVYGRNYFT----RYDYEECASDPCNEMVATME-------KTITAPEFVGKS 458
            :|:|:  :|..:|..|..:.||    .|...||...|...:|..:|       |.|...:.:...
  Rat    53 SGRGV--VLMDNWPGYDLDLFTYPQHYYGDLECVLIPHGIIVDRIERLAKDIMKDIGYHDILVLC 115

  Fly   459 YSSGG-------------------------------KTYKVKE------ADNFSYTDPVDKSVAT 486
            ...||                               |:|||.:      :.....|..||::   
  Rat   116 VLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYKVFQDWAFLGSSGHPGTHSVDQA--- 177

  Fly   487 KQGLRIVFEDGSRIVVRLSGTGS----------------------------SGATVRLYIDSYE- 522
              ||.::.:..:.:|:||....|                            :|.|:...:.|.| 
  Rat   178 --GLELIRDAPALLVLRLKNDRSMGEMQIIGGEDLSTLAGKNVLIVEDVVGTGRTMEALLSSIEK 240

  Fly   523 -KENVLGQASVMLK 535
             |.|::..||:::|
  Rat   241 YKPNMVKVASLLVK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgm1NP_524675.1 PLN02307 1..560 CDD:177942 39/209 (19%)
PGM1 6..560 CDD:100087 39/209 (19%)
Prtfdc1XP_038951494.1 PRTases_typeI 37..342 CDD:412297 39/209 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.