DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgm1 and Hprt1

DIOPT Version :9

Sequence 1:NP_524675.1 Gene:Pgm1 / 44010 FlyBaseID:FBgn0003076 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_036715.1 Gene:Hprt1 / 24465 RGDID:2826 Length:218 Species:Rattus norvegicus


Alignment Length:209 Identity:37/209 - (17%)
Similarity:69/209 - (33%) Gaps:79/209 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 GKPFTVEVIDSV----ANYVRHMEEIFDFAKLKDFVSGKATGKPLKMRIDAMNGVTGSYVREIFL 238
            |..|..:::|.:    .|..|.:....||.:||.:.:.::||....:..|.::.:||.       
  Rat    71 GYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGK------- 128

  Fly   239 NRLGATESSVVHTTPLPDFGGLHPDPNLTYAKDLVDTVAQGDYDIGAAFDGDGDRNMIIGSKAFF 303
                                      |:...:|::||             |...:.::...|.: 
  Rat   129 --------------------------NVLIVEDIIDT-------------GKTMQTLLSLVKQY- 153

  Fly   304 VTPSDSLAVIAHYLEAIPYFQKNGVQGFARSMPTASAVDLVGRKLGKEVFEVP----TGW--KYF 362
               |..:..:|..|          |:..:||:  ....|.||       ||:|    .|:  .|.
  Rat   154 ---SPKMVKVASLL----------VKRTSRSV--GYRPDFVG-------FEIPDKFVVGYALDYN 196

  Fly   363 GNLMDAGRLCLCGE 376
            .:..|...:|:..|
  Rat   197 EHFRDLNHVCVISE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgm1NP_524675.1 PLN02307 1..560 CDD:177942 37/209 (18%)
PGM1 6..560 CDD:100087 37/209 (18%)
Hprt1NP_036715.1 PRTases_typeI 6..218 CDD:294217 37/209 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.