DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgm1 and Hprt1

DIOPT Version :10

Sequence 1:NP_524675.1 Gene:Pgm1 / 44010 FlyBaseID:FBgn0003076 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_038584.2 Gene:Hprt1 / 15452 MGIID:96217 Length:218 Species:Mus musculus


Alignment Length:124 Identity:27/124 - (21%)
Similarity:46/124 - (37%) Gaps:30/124 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 GKPFTVEVIDSV----ANYVRHMEEIFDFAKLKDFVSGKATGKPLKMRIDAMNGVTGSYV----- 233
            |..|..:::|.:    .|..|.:....||.:||.:.:.::||....:..|.::.:||..|     
Mouse    71 GYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVED 135

  Fly   234 -------REIFLNRLGATESSVVHTTPL------------PDFGGLH-PDPNLT-YAKD 271
                   .:..|:.:......:|....|            |||.|.. ||..:. ||.|
Mouse   136 IIDTGKTMQTLLSLVKQYSPKMVKVASLLVKRTSRSVGYRPDFVGFEIPDKFVVGYALD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgm1NP_524675.1 PGM1 6..560 CDD:100087 27/124 (22%)
Hprt1NP_038584.2 PRTases_typeI 6..218 CDD:444823 27/124 (22%)

Return to query results.
Submit another query.