DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H3-5 and His3:CG33845

DIOPT Version :9

Sequence 1:NP_001013721.2 Gene:H3-5 / 440093 HGNCID:33164 Length:135 Species:Homo sapiens
Sequence 2:NP_001027353.1 Gene:His3:CG33845 / 3772421 FlyBaseID:FBgn0053845 Length:136 Species:Drosophila melanogaster


Alignment Length:136 Identity:128/136 - (94%)
Similarity:130/136 - (95%) Gaps:1/136 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGV-KPHRYRPGTVALREIRRYQKSTELLIRK 64
            |||||||||||||||||||||||||||||.|:|.|| ||||||||||||||||||||||||||||
  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

Human    65 LPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARR 129
            ||||||||||||||.|||||||:||.|||||||||||||.|||||||||||||||||||||||||
  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

Human   130 IRGERA 135
            ||||||
  Fly   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H3-5NP_001013721.2 PTZ00018 1..135 CDD:185400 126/134 (94%)
Histone 1..131 CDD:278551 122/130 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 36/40 (90%)
His3:CG33845NP_001027353.1 PTZ00018 1..136 CDD:185400 126/134 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X183
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.