DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hex-C and AT1G47845

DIOPT Version :9

Sequence 1:NP_524674.1 Gene:Hex-C / 44008 FlyBaseID:FBgn0001187 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001321727.1 Gene:AT1G47845 / 28717337 AraportID:AT1G47845 Length:186 Species:Arabidopsis thaliana


Alignment Length:156 Identity:46/156 - (29%)
Similarity:87/156 - (55%) Gaps:20/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 VIVNAEWGAFGEGGQLDFVRTEYDREVDEKSLNRSEQLFEKMTAGMYLGNLVRLVLLRALERKLI 305
            :|:|.|||.|.:    ...:|.:|:|:|.:|.||.|.|:|||.:|||||.:||.|||:..|...:
plant    40 MIINTEWGGFSK----VLPQTIFDQEMDAESPNRGEHLYEKMVSGMYLGEIVRRVLLQMCETSDL 100

  Fly   306 FKQ-----SSRRPEFASVLQRNEEVFETRYISEIEDDSFPEFASTRKIVKNLFGLEKASVEDCQT 365
            |.|     :..:| ||         .:|.:::::::|:..:..:...::.|:..:| |::::.:.
plant   101 FGQFVPGGNLSKP-FA---------LKTEHLNKMQEDTTDDLQTVGLVLYNILEVE-ANLQERRR 154

  Fly   366 LRYICECVAKRAATLVAIGVSGLVNR 391
            :..:|:.|.||...|...||:..:.:
plant   155 VVEVCDTVVKRGGRLAGAGVNARIKQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hex-CNP_524674.1 Hexokinase_1 5..200 CDD:278764
PTZ00107 13..454 CDD:240270 46/156 (29%)
Hexokinase_2 207..449 CDD:281689 46/156 (29%)
AT1G47845NP_001321727.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 128 1.000 Domainoid score I1730
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153545at2759
OrthoFinder 1 1.000 - - FOG0000301
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.