DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq7 and coq7

DIOPT Version :9

Sequence 1:NP_651967.2 Gene:Coq7 / 44007 FlyBaseID:FBgn0029502 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001016068.2 Gene:coq7 / 548822 XenbaseID:XB-GENE-941459 Length:222 Species:Xenopus tropicalis


Alignment Length:171 Identity:102/171 - (59%)
Similarity:130/171 - (76%) Gaps:1/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ALTDEIIRVDHAGELGADRIYAGQMAILGNGPLGKTIGHMWEQEKEHRKQFEQLIQQHRVRPTIM 114
            |:.|.|||||||||.||:||||||||:||...:|..|.|||:|||||.|:|.:|:..||||||::
 Frog    52 AVLDRIIRVDHAGEYGANRIYAGQMAVLGRSTVGPIIQHMWDQEKEHLKKFSELMVSHRVRPTVL 116

  Fly   115 TPIWNVAGFVLGAGTALMGEKAAMACTVAVETVIVEHYNDQLRQIMEA-PNPDKELLATITKFRD 178
            .|:||||||.|||||||:|:|.|||||||||..|.||:|.|:|.:||: |...:.||.||.|.||
 Frog   117 MPLWNVAGFALGAGTALLGKKGAMACTVAVEASISEHFNSQIRTLMESDPEKHRALLQTIKKCRD 181

  Fly   179 EEQEHHDTGIDHGAEQAPFYQAMTEVIKFGCKTAIAISKKI 219
            :|.||||||::|.||.||.|..:...|:.||:.||.:|:::
 Frog   182 DELEHHDTGLEHDAELAPGYFLLKNAIQLGCRAAIFLSERV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq7NP_651967.2 COQ7 51..219 CDD:281254 101/168 (60%)
coq7NP_001016068.2 COQ7 54..222 CDD:308712 101/167 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 213 1.000 Domainoid score I2702
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6953
Inparanoid 1 1.050 215 1.000 Inparanoid score I3523
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1242061at2759
OrthoFinder 1 1.000 - - FOG0004769
OrthoInspector 1 1.000 - - oto104841
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R237
SonicParanoid 1 1.000 - - X3354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.