DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq7 and coq7

DIOPT Version :9

Sequence 1:NP_651967.2 Gene:Coq7 / 44007 FlyBaseID:FBgn0029502 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_595416.1 Gene:coq7 / 2541024 PomBaseID:SPBC337.15c Length:216 Species:Schizosaccharomyces pombe


Alignment Length:181 Identity:88/181 - (48%)
Similarity:122/181 - (67%) Gaps:6/181 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LRPRPNALTDEIIRVDHAGELGADRIYAGQMAIL--GNGPLGKTIGHMWEQEKEHRKQFEQLIQQ 106
            |..:.:.:.|.:||||.||||||::||.||..||  .:..:..||.|||:|||.|...|:..:.:
pombe    35 LSEKDSNILDSVIRVDQAGELGANQIYKGQHFILQFTDPKVAPTIQHMWDQEKYHLATFDNYVLK 99

  Fly   107 HRVRPTIMTPIWNVAGFVLGAGTALMGEKAAMACTVAVETVIVEHYNDQLRQIMEAPN--PD-KE 168
            :|||||.:.|.|::|||.|||||||:|.|||||||.||||||..|||||||:.....|  |: ||
pombe   100 NRVRPTFLRPFWDIAGFALGAGTALLGTKAAMACTEAVETVIGGHYNDQLRETAHLENKAPEFKE 164

  Fly   169 LLATITKFRDEEQEHHDTGID-HGAEQAPFYQAMTEVIKFGCKTAIAISKK 218
            :.:.:.:|||:|.||.:|.:: ..|::||.:..:|..|:.|||.||.:.|:
pombe   165 IRSHLAEFRDDELEHLNTAVEGWNAKEAPAHALLTNAIQMGCKAAIWMCKR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq7NP_651967.2 COQ7 51..219 CDD:281254 87/174 (50%)
coq7NP_595416.1 Coq7 1..216 CDD:225492 88/181 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 165 1.000 Domainoid score I941
eggNOG 1 0.900 - - E1_COG2941
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6953
Inparanoid 1 1.050 166 1.000 Inparanoid score I1211
OMA 1 1.010 - - QHG55898
OrthoFinder 1 1.000 - - FOG0004769
OrthoInspector 1 1.000 - - oto101806
orthoMCL 1 0.900 - - OOG6_104460
Panther 1 1.100 - - LDO PTHR11237
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R237
SonicParanoid 1 1.000 - - X3354
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.