DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq7 and clk-1

DIOPT Version :9

Sequence 1:NP_651967.2 Gene:Coq7 / 44007 FlyBaseID:FBgn0029502 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_498128.1 Gene:clk-1 / 175729 WormBaseID:WBGene00000536 Length:187 Species:Caenorhabditis elegans


Alignment Length:171 Identity:90/171 - (52%)
Similarity:127/171 - (74%) Gaps:1/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ALTDEIIRVDHAGELGADRIYAGQMAILGNGPLGKTIGHMWEQEKEHRKQFEQLIQQHRVRPTIM 114
            ||.::|||||||||||||||||||:|:|....:|..|..||::||||....|:|..:|.|..|:.
 Worm    17 ALIEKIIRVDHAGELGADRIYAGQLAVLQGSSVGSVIKKMWDEEKEHLDTMERLAAKHNVPHTVF 81

  Fly   115 TPIWNVAGFVLGAGTALMGEKAAMACTVAVETVIVEHYNDQLRQIM-EAPNPDKELLATITKFRD 178
            :|:::||.:.||.|:||:|::.|||||:|||.:|.:||||||:::: :.|...||||..:|:.||
 Worm    82 SPVFSVAAYALGVGSALLGKEGAMACTIAVEELIGQHYNDQLKELLADDPETHKELLKILTRLRD 146

  Fly   179 EEQEHHDTGIDHGAEQAPFYQAMTEVIKFGCKTAIAISKKI 219
            ||..|||||::|...:||.|.|:..:|:.|||.||||::||
 Worm   147 EELHHHDTGVEHDGMKAPAYSALKWIIQTGCKGAIAIAEKI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq7NP_651967.2 COQ7 51..219 CDD:281254 87/168 (52%)
clk-1NP_498128.1 COQ7 18..187 CDD:281254 87/168 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159763
Domainoid 1 1.000 190 1.000 Domainoid score I1925
eggNOG 1 0.900 - - E1_COG2941
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6953
Inparanoid 1 1.050 193 1.000 Inparanoid score I2546
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55898
OrthoDB 1 1.010 - - D1242061at2759
OrthoFinder 1 1.000 - - FOG0004769
OrthoInspector 1 1.000 - - oto19112
orthoMCL 1 0.900 - - OOG6_104460
Panther 1 1.100 - - LDO PTHR11237
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R237
SonicParanoid 1 1.000 - - X3354
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.