DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq7 and Coq7

DIOPT Version :9

Sequence 1:NP_651967.2 Gene:Coq7 / 44007 FlyBaseID:FBgn0029502 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001291687.1 Gene:Coq7 / 12850 MGIID:107207 Length:337 Species:Mus musculus


Alignment Length:203 Identity:107/203 - (52%)
Similarity:129/203 - (63%) Gaps:29/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GMLRRGLSRPEPRLLSKRYLSSATGGG------SAGTTEGGSSETTPLRPRPNALTDEIIRVDHA 61
            |.||.|:.||          .|..|.|      |:|.|         |.....|..|.|||||||
Mouse    13 GRLRTGVRRP----------FSEYGRGLIIRCHSSGMT---------LDNINRAAVDRIIRVDHA 58

  Fly    62 GELGADRIYAGQMAILGNGPLGKTIGHMWEQEKEHRKQFEQLIQQHRVRPTIMTPIWNVAGFVLG 126
            ||.||:||||||||:||...:|..|..||:|||.|.|:|.:|:...|||||::.|:||||||.||
Mouse    59 GEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMIAFRVRPTVLMPLWNVAGFALG 123

  Fly   127 AGTALMGEKAAMACTVAVETVIVEHYNDQLRQIMEAPNPDK--ELLATITKFRDEEQEHHDTGID 189
            |||||:|::.|||||||||..|..|||:|:|.:|| .:|:|  |||..|.:|||||.||||||:|
Mouse   124 AGTALLGKEGAMACTVAVEESIANHYNNQIRMLME-EDPEKYEELLQVIKQFRDEELEHHDTGLD 187

  Fly   190 HGAEQAPF 197
            |.|| .||
Mouse   188 HDAE-LPF 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq7NP_651967.2 COQ7 51..219 CDD:281254 93/149 (62%)
Coq7NP_001291687.1 COQ7 49..191 CDD:281254 82/143 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837884
Domainoid 1 1.000 207 1.000 Domainoid score I2897
eggNOG 1 0.900 - - E1_COG2941
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6953
Inparanoid 1 1.050 208 1.000 Inparanoid score I3692
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55898
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004769
OrthoInspector 1 1.000 - - oto94649
orthoMCL 1 0.900 - - OOG6_104460
Panther 1 1.100 - - LDO PTHR11237
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R237
SonicParanoid 1 1.000 - - X3354
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.