DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq7 and COQ7

DIOPT Version :9

Sequence 1:NP_651967.2 Gene:Coq7 / 44007 FlyBaseID:FBgn0029502 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_057222.2 Gene:COQ7 / 10229 HGNCID:2244 Length:217 Species:Homo sapiens


Alignment Length:216 Identity:112/216 - (51%)
Similarity:141/216 - (65%) Gaps:20/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRGLSRPEPRLLSKRYLSSATGGGSAGTTEGGSSETTPLRPRPNALTDEIIRVDHAGELGADRIY 70
            ||.|| ...|..|.|:.||       |.|....|         .|..|.|||||||||.||:|||
Human    20 RRSLS-AYGRRTSVRFRSS-------GMTLDNIS---------RAAVDRIIRVDHAGEYGANRIY 67

  Fly    71 AGQMAILGNGPLGKTIGHMWEQEKEHRKQFEQLIQQHRVRPTIMTPIWNVAGFVLGAGTALMGEK 135
            |||||:||...:|..|..||:|||:|.|:|.:|:...|||||::.|:|||.||.|||||||:|::
Human    68 AGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKE 132

  Fly   136 AAMACTVAVETVIVEHYNDQLRQIMEAPNPDK--ELLATITKFRDEEQEHHDTGIDHGAEQAPFY 198
            .|||||||||..|..|||:|:|.:|| .:|:|  |||..|.||||||.||||.|:||.||.||.|
Human   133 GAMACTVAVEESIAHHYNNQIRTLME-EDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAY 196

  Fly   199 QAMTEVIKFGCKTAIAISKKI 219
            ..:..:|:.||:.||.:|:::
Human   197 AVLKSIIQAGCRVAIYLSERL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq7NP_651967.2 COQ7 51..219 CDD:281254 99/169 (59%)
COQ7NP_057222.2 2 X approximate tandem repeats 48..217 99/169 (59%)
COQ7 49..216 CDD:308712 99/167 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147803
Domainoid 1 1.000 206 1.000 Domainoid score I2919
eggNOG 1 0.900 - - E1_COG2941
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6953
Inparanoid 1 1.050 208 1.000 Inparanoid score I3700
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55898
OrthoDB 1 1.010 - - D1242061at2759
OrthoFinder 1 1.000 - - FOG0004769
OrthoInspector 1 1.000 - - oto91064
orthoMCL 1 0.900 - - OOG6_104460
Panther 1 1.100 - - LDO PTHR11237
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.