DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fad2 and AT1G06100

DIOPT Version :9

Sequence 1:NP_651966.2 Gene:Fad2 / 44006 FlyBaseID:FBgn0029172 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_172100.1 Gene:AT1G06100 / 837119 AraportID:AT1G06100 Length:299 Species:Arabidopsis thaliana


Alignment Length:319 Identity:90/319 - (28%)
Similarity:144/319 - (45%) Gaps:45/319 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TVDGGLSTELSNRKTTDGSKLELVWVNIVLFVILHISSLYGVWLLFTSA----TWTT----VVLF 75
            |.|.|.|.:.|.||......|. .|..   |.:...|::..|.||...|    .|..    ::| 
plant     5 TKDDGSSQKKSVRKEKRAYVLR-KWTQ---FDVGRASTVGTVHLLCLLAPFNYKWEAFRFGIIL- 64

  Fly    76 WPTVVVTILGVSGGAHRLWAHRTFKANTPLKLIFLFLNTLAFQDAVYYWARDHRVHHKYTETDAD 140
               .::|.|.::...||...||:||....|:..|.:...||.|.....|...||.||::|::|.|
plant    65 ---AILTNLCITFSYHRNLTHRSFKLPKWLEYPFAYSALLALQGDPLDWVSIHRFHHQFTDSDRD 126

  Fly   141 PYNSQRGWFFAHIGWLCCRKHPEVVEK-GKQIDLSDLEADPLIMFQKKYYLLLMPIICFVLPTVL 204
            |::...|::|:|:.|:....:  :.|| |::.::.||:......|.||  .|::.|:.|.  |::
plant   127 PHSPIEGFWFSHVLWIFDTDY--IREKCGRRNNVMDLKQQWFYRFLKK--TLVLHILAFW--TLI 185

  Fly   205 PMYLWGESLNVSWHVMALLRWCLSLNLI------WTVNSSAHMHGMRPYDKNICPVDQGFLIFFR 263
              ||||.        :..|.|.:....:      |.|||:.|:.|.:.:..|....:..:|....
plant   186 --YLWGG--------LPYLTWTVGFGGVIGYHGTWLVNSACHICGSQAWQTNDTSRNVWWLALLT 240

  Fly   264 VGEGYHNYHHVFPWDYKSAELGK--YSQDVTTKFIEFMAYLGWAYDLKSVSLDLVKQRV 320
            :||.:||.||.|.   .||..|.  |..|:|...|.|...||.|.::| :..|..|:::
plant   241 MGESWHNNHHAFE---TSARHGLEWYQLDITWYLIWFFQALGLATNVK-LPTDAQKRKM 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fad2NP_651966.2 Delta9-FADS-like 68..309 CDD:239582 72/253 (28%)
AT1G06100NP_172100.1 PLN02220 1..299 CDD:177866 90/319 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 1 0.900 - - OOG6_100468
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.