DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fad2 and ADS1

DIOPT Version :9

Sequence 1:NP_651966.2 Gene:Fad2 / 44006 FlyBaseID:FBgn0029172 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_172098.1 Gene:ADS1 / 837117 AraportID:AT1G06080 Length:305 Species:Arabidopsis thaliana


Alignment Length:302 Identity:83/302 - (27%)
Similarity:134/302 - (44%) Gaps:53/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KTTDGSKLELVWVN--IVLFVILHISSLYGVWL-LFTSATWTTVVLFWPT-----VVVTI--LGV 86
            |...|.|...:|..  ..|.::...:||:..:| |.....:|     ||.     :|.|:  ||:
plant    19 KAEMGRKKRAMWERKWKRLDIVKAFASLFVHFLCLLAPFNFT-----WPALRVALIVYTVGGLGI 78

  Fly    87 SGGAHRLWAHRTFKANTPLKLIFLFLNTLAFQDAVYYWARDHRVHHKYTETDADPYNSQRGWFFA 151
            :...||..|||:||....|:..|.:...||.|.....|...||.||::|::|.||::...|::|:
plant    79 TVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQGDPIDWVSTHRYHHQFTDSDRDPHSPNEGFWFS 143

  Fly   152 HIGWLCCRKHPEVVEK-GKQIDLSDLEADPLIMFQKKYYLLLMPIICFVLPTV---------LPM 206
            |:.||....:  :||| |::.::.||:       ::.||..|...:.:.:.|.         |..
plant   144 HLLWLFDTGY--LVEKCGRRTNVEDLK-------RQWYYKFLQRTVLYHILTFGFLLYYFGGLSF 199

  Fly   207 YLWGESLNVSW--HVMALLRWCLSLNLIWTVNSSAHMHGMRPYDKNICPVDQGFLIFFRVGEGYH 269
            ..||..:.|:.  ||..|            :||..|:.|.|.:..|....:..:|..|..||.:|
plant   200 LTWGMGIGVAMEHHVTCL------------INSLCHVWGSRTWKTNDTSRNVWWLSVFSFGESWH 252

  Fly   270 NYHHVFPWDYKSAELGK--YSQDVTTKFIEFMAYLGWAYDLK 309
            |.||.|.   .||..|.  :..|::...:.|:..:|.|.|:|
plant   253 NNHHAFE---SSARQGLEWWQIDISWYIVRFLEIIGLATDVK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fad2NP_651966.2 Delta9-FADS-like 68..309 CDD:239582 73/261 (28%)
ADS1NP_172098.1 PLN02220 1..305 CDD:177866 83/302 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 1 0.900 - - OOG6_100468
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.