DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fad2 and ADS2

DIOPT Version :9

Sequence 1:NP_651966.2 Gene:Fad2 / 44006 FlyBaseID:FBgn0029172 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001323798.1 Gene:ADS2 / 817694 AraportID:AT2G31360 Length:307 Species:Arabidopsis thaliana


Alignment Length:267 Identity:73/267 - (27%)
Similarity:123/267 - (46%) Gaps:40/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ISSLYGVWLLFTSATWTTVVLFWPTVVVTI--LGVSGGAHRLWAHRTFKANTPLKLIFLFLNTLA 116
            ::..|..|    ||.|.|.:.:      ||  ||::...||..|||:||....|:.:..:...||
plant    56 LAPFYFTW----SALWVTFLFY------TIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLA 110

  Fly   117 FQDAVYYWARDHRVHHKYTETDADPYNSQRGWFFAHIGWLCCRKHPEVVEK-GKQIDLSDLEADP 180
            .|.....|...||.||::|:::.||::.:.|::|:|:.|:....:  :|.| |::.::.||:...
plant   111 IQGDPIDWVSTHRYHHQFTDSERDPHSPKEGFWFSHLLWIYDSAY--LVSKCGRRANVEDLKRQW 173

  Fly   181 LIMFQKKYYLLLMPIICFVLPTVLPMYLWGESLNVSWHVMALLRW------CLSLNLIWTVNSSA 239
            ...|.:|..|..:..:.|.|     .||.|         |:.:.|      .|.:::...:||..
plant   174 FYRFLQKTVLFHILGLGFFL-----FYLGG---------MSFVTWGMGVGAALEVHVTCLINSLC 224

  Fly   240 HMHGMRPYDKNICPVDQGFLIFFRVGEGYHNYHHVFPWDYKSAELGK--YSQDVTTKFIEFMAYL 302
            |:.|.|.:..|....:..:|..|..||.:||.||.|.   .||..|.  :..|::...:.|...:
plant   225 HIWGTRTWKTNDTSRNVWWLSVFSFGESWHNNHHAFE---SSARQGLEWWQIDISWYIVRFFEII 286

  Fly   303 GWAYDLK 309
            |.|.|:|
plant   287 GLATDVK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fad2NP_651966.2 Delta9-FADS-like 68..309 CDD:239582 68/251 (27%)
ADS2NP_001323798.1 PLN02220 1..307 CDD:177866 73/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 1 0.900 - - OOG6_100468
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.