DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fad2 and CG15531

DIOPT Version :9

Sequence 1:NP_651966.2 Gene:Fad2 / 44006 FlyBaseID:FBgn0029172 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_651780.1 Gene:CG15531 / 43592 FlyBaseID:FBgn0039755 Length:334 Species:Drosophila melanogaster


Alignment Length:322 Identity:106/322 - (32%)
Similarity:171/322 - (53%) Gaps:34/322 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ELSNRKTTDGS------KLELVWVNIVLFVILHISSLYGVWLLFTSATWTTVVLFWPTVVVTILG 85
            |.:..|..|.|      |.:.:|..::.::.|:|..:||:::|.|||:|.|::.   |.::|:||
  Fly     2 ETTKVKEPDQSGDSIHKKRDAIWPLVLFYIHLNILGVYGIYVLLTSASWATILF---TALLTLLG 63

  Fly    86 VSG---GAHRLWAHRTFKANTPLKLIFLFLNTLAFQDAVYYWARDHRVHHKYTETDADPYNSQRG 147
            ..|   |.|||||||||.|:.|||:..:|..|.|.|.::|...:.||:||...:.|.|||.|:..
  Fly    64 TLGVTVGVHRLWAHRTFTASKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDEDPYYSKHS 128

  Fly   148 WFFAHIGWLCCRKHPEVVEKGKQIDLSDLEADPLIMFQKKYYLLLMPIICFVLPTVLPMYLWGES 212
            :.:|.:.....:..|:..|..|.:|:||||:||::||||::|:||...:..:|....|...:|:|
  Fly   129 FMYAQVRGGLLKYSPQQEELLKDVDMSDLESDPVVMFQKRFYVLLYIFLNVLLSVNTPFQYFGDS 193

  Fly   213 LNVSWHVMALLRWCLSLNL---------IWTVNSSAHMHGMRPYDKNICPVDQGFLIFFRVGEGY 268
            |..|..|...||..:.:||         ||:::.     |.:|.|.|        .||......:
  Fly   194 LATSMFVGFWLRSLIVINLGNLVHSSHFIWSIHK-----GFKPTDSN--------SIFLITKSYW 245

  Fly   269 HNYHHVFPWDYKSAELGKYSQDVTTKFIEFMAYLGWAYDLKSVSLDLVKQRVQRSGDGSHPV 330
            ..||::.|.||:|.|.|.|:..:.:..|...|.|.||.|||::....|:|.:.::.:...|:
  Fly   246 PQYHYLLPRDYQSGEYGNYASGIGSSMIRVFAALDWAKDLKTIGSVAVRQGLTKAVETGRPI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fad2NP_651966.2 Delta9-FADS-like 68..309 CDD:239582 87/252 (35%)
CG15531NP_651780.1 Delta9-FADS-like 49..286 CDD:239582 87/252 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1398
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1806
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D971318at2759
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - mtm1155
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X207
87.970

Return to query results.
Submit another query.