DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fad2 and Scd

DIOPT Version :9

Sequence 1:NP_651966.2 Gene:Fad2 / 44006 FlyBaseID:FBgn0029172 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_631931.2 Gene:Scd / 246074 RGDID:621176 Length:358 Species:Rattus norvegicus


Alignment Length:296 Identity:154/296 - (52%)
Similarity:210/296 - (70%) Gaps:12/296 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KLELVWVNIVLFVILHISSLYGVWLLFTSATWTTVVLFWPT--VVVTILGVSGGAHRLWAHRTFK 100
            |||.||.||:|..:||:.:|||:.|:.:|..:|   |.|..  .:::.||::.||||||:|||:|
  Rat    67 KLEYVWRNIILMALLHVGALYGITLIPSSKVYT---LLWGIFYYLISALGITAGAHRLWSHRTYK 128

  Fly   101 ANTPLKLIFLFLNTLAFQDAVYYWARDHRVHHKYTETDADPYNSQRGWFFAHIGWLCCRKHPEVV 165
            |..||::..:..||:|||:.||.||||||.|||::||.|||:||:||:||:|:|||..||||.|.
  Rat   129 ARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVK 193

  Fly   166 EKGKQIDLSDLEADPLIMFQKKYY---LLLMPIICFVLPTVLPMYLWGESLNVSWHVMALLRWCL 227
            |||.::|:|||:|:.|:|||::||   ||||   ||:|||::|.|.|||:...|..|...||:.|
  Rat   194 EKGGKLDMSDLKAEKLVMFQRRYYKPGLLLM---CFILPTLVPWYCWGETFLHSLFVSTFLRYTL 255

  Fly   228 SLNLIWTVNSSAHMHGMRPYDKNICPVDQGFLIFFRVGEGYHNYHHVFPWDYKSAELGKYSQDVT 292
            .||..|.|||:||::|.|||||||...:...:....||||:|||||.||:||.::|. ::..:.|
  Rat   256 VLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHHAFPYDYSASEY-RWHINFT 319

  Fly   293 TKFIEFMAYLGWAYDLKSVSLDLVKQRVQRSGDGSH 328
            |.||:.||.||.|||.|.||...|..|::|:|||||
  Rat   320 TFFIDCMAALGLAYDRKKVSKAAVLARIKRTGDGSH 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fad2NP_651966.2 Delta9-FADS-like 68..309 CDD:239582 128/245 (52%)
ScdNP_631931.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 8..33
Delta9-FADS-like 99..336 CDD:239582 128/243 (53%)
FA_desaturase 100..305 CDD:278890 112/207 (54%)
Histidine box-1. /evidence=ECO:0000305 119..124 4/4 (100%)
Histidine box-2. /evidence=ECO:0000305 156..160 2/3 (67%)
Histidine box-3. /evidence=ECO:0000305 297..301 3/3 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348774
Domainoid 1 1.000 292 1.000 Domainoid score I1461
eggNOG 1 0.900 - - E1_COG1398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 366 1.000 Inparanoid score I2092
OMA 1 1.010 - - QHG63267
OrthoDB 1 1.010 - - D296120at33208
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - mtm8949
orthoMCL 1 0.900 - - OOG6_100468
Panther 1 1.100 - - O PTHR11351
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X207
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.