DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and NHP2

DIOPT Version :9

Sequence 1:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_010073.2 Gene:NHP2 / 851319 SGDID:S000002367 Length:156 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:63/167 - (37%)
Similarity:94/167 - (56%) Gaps:22/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKVKVERSEDADESVVASGDVTIKEEESYDDKLIFVNAIAKPMAGKKLAKKCYKLVKKAMKHKT 65
            |||...|..|..:...|          ::|:.::..|...|||:|.|||.||..|.||||.|.|.
Yeast     1 MGKDNKEHKESKESKTV----------DNYEARMPAVLPFAKPLASKKLNKKVLKTVKKASKAKN 55

  Fly    66 FLRNGLKDVQTRLRKGETGICIFAGDVTPVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMGVKRG 130
             ::.|:|:|...|||||.|:.:.|||::|.|::.|:|.:||:..:||.:.||:.|||||...||.
Yeast    56 -VKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRP 119

  Fly   131 TVALLV-----------RQNEEYKDLYDEVKEELSAL 156
            |..:.:           .:.||||:.::||.:|:.||
Yeast   120 TSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 43/105 (41%)
NHP2NP_010073.2 Rpl7Ae 30..143 CDD:224277 50/123 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343090
Domainoid 1 1.000 84 1.000 Domainoid score I1916
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5524
Inparanoid 1 1.050 115 1.000 Inparanoid score I1343
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53726
OrthoFinder 1 1.000 - - FOG0004692
OrthoInspector 1 1.000 - - oto100000
orthoMCL 1 0.900 - - OOG6_102271
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R810
SonicParanoid 1 1.000 - - X3297
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.