DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and AT5G08180

DIOPT Version :9

Sequence 1:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001190260.1 Gene:AT5G08180 / 830714 AraportID:AT5G08180 Length:156 Species:Arabidopsis thaliana


Alignment Length:156 Identity:57/156 - (36%)
Similarity:93/156 - (59%) Gaps:26/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DADESVVASGDVTIKEEESYDDKLIFVNAIAKPMAGKKLAKKCYKLVKKAMKHKTFLRNGLKDVQ 75
            :|::|:.       ||::.|   .|.:..||||:|||||.|:.:||::||...|. |:.|:|:|.
plant     6 EAEKSIQ-------KEKKKY---AITLAPIAKPLAGKKLQKRTFKLIQKAAGKKC-LKRGVKEVV 59

  Fly    76 TRLRKGETGICIFAGDVTPVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMGVKRGTVALLV---- 136
            ..:|:|:.|:|:.||:::|:|::.|||.:|||.|:||.|.||:.||..|...||.|..:||    
plant    60 KSIRRGQKGLCVIAGNISPIDVITHLPILCEEAGVPYVYVPSKEDLAQAGATKRPTCCVLVMLKP 124

  Fly   137 -----------RQNEEYKDLYDEVKE 151
                       :...:|:.:.|::||
plant   125 AKGDLTAEELAKLKTDYEQVSDDIKE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 39/109 (36%)
AT5G08180NP_001190260.1 SNU13 24..151 CDD:411046 51/128 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2801
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5524
Inparanoid 1 1.050 109 1.000 Inparanoid score I2081
OMA 1 1.010 - - QHG53726
OrthoDB 1 1.010 - - D1538526at2759
OrthoFinder 1 1.000 - - FOG0004692
OrthoInspector 1 1.000 - - oto3215
orthoMCL 1 0.900 - - OOG6_102271
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.