DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and NHP2

DIOPT Version :9

Sequence 1:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_060308.1 Gene:NHP2 / 55651 HGNCID:14377 Length:153 Species:Homo sapiens


Alignment Length:160 Identity:67/160 - (41%)
Similarity:104/160 - (65%) Gaps:7/160 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKVKVERSEDADESVVASGDVTIKEEESYDDKLIFVNAIAKPMAGKKLAKKCYKLVKKAMKHKT 65
            |.|:|.:......::...||      |.:|.:.|:..|.||:|:|.::|.:|.||.:|||:|.|.
Human     1 MTKIKADPDGPEAQAEACSG------ERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQ 59

  Fly    66 FLRNGLKDVQTRLRKGETGICIFAGDVTPVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMGVKRG 130
             :|.|:|:||..:.|||.||.:.|||..|:::.||||.:||::.:||.|.||:.|||||.|.||.
Human    60 -IRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRP 123

  Fly   131 TVALLVRQNEEYKDLYDEVKEELSALNIPV 160
            |..::|:.:|||::.|||..||:.:|.:|:
Human   124 TCVIMVKPHEEYQEAYDECLEEVQSLPLPL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 46/94 (49%)
NHP2NP_060308.1 SNU13 32..130 CDD:411046 47/97 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144917
Domainoid 1 1.000 106 1.000 Domainoid score I6595
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5524
Inparanoid 1 1.050 143 1.000 Inparanoid score I4463
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53726
OrthoDB 1 1.010 - - D1538526at2759
OrthoFinder 1 1.000 - - FOG0004692
OrthoInspector 1 1.000 - - oto90873
orthoMCL 1 0.900 - - OOG6_102271
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R810
SonicParanoid 1 1.000 - - X3297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.