DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NHP2 and Nhp2

DIOPT Version :9

Sequence 1:NP_001261849.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_080907.1 Gene:Nhp2 / 52530 MGIID:1098547 Length:153 Species:Mus musculus


Alignment Length:162 Identity:71/162 - (43%)
Similarity:104/162 - (64%) Gaps:11/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKVKV--ERSEDADESVVASGDVTIKEEESYDDKLIFVNAIAKPMAGKKLAKKCYKLVKKAMKH 63
            |.|||.  |.||...|.        ..||.:|.:.|:.:|.||:|:|.::|.:|.||.:|||:|.
Mouse     1 MTKVKAAPEESEAQAEG--------CSEERTYKELLVNLNPIAQPLASRRLTRKLYKCIKKAVKQ 57

  Fly    64 KTFLRNGLKDVQTRLRKGETGICIFAGDVTPVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMGVK 128
            |. :|.|:|:||..:.|||.||.:.|||..|:::.||||.:||::.:||.|.||:.|||||.|.|
Mouse    58 KQ-IRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVLCEDQNLPYVYIPSKTDLGAATGSK 121

  Fly   129 RGTVALLVRQNEEYKDLYDEVKEELSALNIPV 160
            |.|..::|:.:|||::.||:..||:.||..|:
Mouse   122 RPTCVIMVKPHEEYQETYDKCLEEVQALPTPL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NHP2NP_001261849.1 Ribosomal_L7Ae 51..146 CDD:396000 46/94 (49%)
Nhp2NP_080907.1 Ribosomal_L7Ae 46..137 CDD:279573 46/91 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835024
Domainoid 1 1.000 106 1.000 Domainoid score I6622
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5524
Inparanoid 1 1.050 142 1.000 Inparanoid score I4460
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53726
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004692
OrthoInspector 1 1.000 - - oto94455
orthoMCL 1 0.900 - - OOG6_102271
Panther 1 1.100 - - LDO PTHR23105
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R810
SonicParanoid 1 1.000 - - X3297
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.